Description

  • Product name

    Recombinant EBV gp340/220 Envelope Protein (Tagged)
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Sequence

      MEAALLVCQYTIQSLIHLTGEDPGFFNVEIPEFPFYPTCNVCTADVNVTI NFDVGGKKHQLDLDFGQLTPHTKAVYQPRGAFGGSENATNLFLLELLGAG ELALTMRSKKLPINVTTGEEQQVSLESVDVYFQDVFGTMWCHHAEMQNPV YLIPETVPYIKWDNCNSTNITAVVRAQGLDVTLPLSLPTSAQDSNFSVKT EMLGNEIDIECIMEDGEISQVLPGDNKFNITCSGYESHVPSGGILTSTSP VATPIPGTGYAYSLRLTPRPVSRFLGNNSILYVFYSGNGPKASGGDYCIQ SNIVFSDEIPASQDMPTNTTDITYVGDNATYSVPMVTSEDANSPNVTVTA FWAWPNNTETDFKCKWTLTSGTPSGCENISGAFASNRTFDITVSGLGTAP KTLIITRTATNATTTTHKVIFSKAPESTTTSPTLNTTGFADPNTTTGLPS STHVPTNLTAPASTGPTVSTADVTSPTPAGTTSGASPVTPSPS
    • Predicted molecular weight

      69 kDa including tags
    • Amino acids

      1 to 493
    • Tags

      His tag N-Terminus
    • Additional sequence information

      Epstein-Barr virus (strain B95-8) (HHV-4) (Human herpesvirus 4). N-terminal 6xHis-SUMO-tag.

Specifications

Our Abpromise guarantee covers the use of ab237750 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names

    • BLLF1a
    • Envelope glycoprotein Gp220/340
    • Envelope glycoprotein GP340/220
    • Envelope glycoprotein GP340/GP220
    • Epstein Barr gp350 envelope protein
    • Epstein Barr virus
    • Epstein Barr Virus envelope glycoprotein complex 250/350
    • gp 350
    • Gp350
    • MA
    • Membrane antigen
    see all
  • Relevance

    Epstein-Barr virus is a member of the herpesvirus family and one of the most common human viruses. The envelope glycoprotein Gp340/Gp220 is the most abundant vomponent of the viral envelope and is believed to be responsible for EBV binding to CR2 receptor on human B-Cells.
  • Cellular localization

    Virion membrane: most abundant component of the viral envelope.

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis with 5% enrichment gel and 15% separation gel of ab237750.

  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of ab237750 could indicate that this peptide derived from E.coli-expressed Epstein-Barr virus (strain B95-8) (HHV-4) (Human herpesvirus 4) gp340/220 Envelope Protein.

  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of ab237750 could indicate that this peptide derived from E.coli-expressed Epstein-Barr virus (strain B95-8) (HHV-4) (Human herpesvirus 4) gp340/220 Envelope Protein.

References

ab237750 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab237750.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up