Recombinant EN-TEV Protease (mutated S219 N) protein (Tagged-His Tag) (ab134877)

Description

  • Product name

    Recombinant EN-TEV Protease (mutated S219 N) protein (Tagged-His Tag)
  • Biological activity

    Complete digestion of 50µg of T7 Tag-HBxAg protein using 1µg TEV enzyme (in 1/50 ratio) in either 3 hours at 37 °C or 12 hours at 4 °C.

    The "standard" reaction buffer for TEV protease is 50 mM Tris-HCl (pH 8.0), 0.5 mM EDTA and 1mM DTT. The duration of the cleavage reaction is typically overnight, although lots of cleavage will happen in the first few hours and prolonged incubation times may not lead to proportional increases in cleavage. TEV protease is maximally active at 34 °C, but we recommend performing the digest at room temperature (20 °C) or 4 °C. TEV protease is only three-fold less active at 4 °C than at 20 °C.
    Typically, a good rule of thumb for initial test of digestion is 1 µg TEV enzyme per 50 - 100µg target protein ratio. Perform a small-scale reaction first, if possible, to gauge the efficiency of processing.

  • Purity

    > 98 % SDS-PAGE.
    ab134877 is sterile-filtered.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Tobacco etch virus
    • Sequence

      GHHHHHHHGESLFKGPRDYNPISSTICHLTNESDGHTTSLYGIGFGPFII TNKHLFRRNNGTLLVQSLHGVFKVKNTTTLQQHLIDGRDMIIIRMPKDFP PFPQKLKFREPQREERICLVTTNFQTKSMSSMVSDTSCTFPSSDGIFWKH WIQTKDGQCGSPLVSTRDGFIVGIHSASNFTNTNNYFTSVPKNFMELLTN QEAQQWVSGWRLNADSVLWGGHKVFMVKPEEPFQPVKEATQLMNRRRRR
    • Amino acids

      2037 to 2073
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab134877 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.02% DTT, 0.79% Tris HCl, 0.015% EDTA

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

Images

  • 4-12% SDS-PAGE gel.

    M: Protein Marker
    Lane 1: N‐terminal tag HBxAg‐11R protein before TEV enzyme digestion.
    Lane 2: N‐terminal tag HBxAg‐11R protein digested using 1/50 dilution (1µg TEV/ 50µg target protein at 4°C for overnight reaction) in buffer 20 mM Tris‐HCl, pH 8.0, 100 mM KCl.

References

ab134877 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab134877.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up