Recombinant Endo-beta-N-acetylglucosaminidase H protein (ab151904)

Description

  • Product name

    Recombinant Endo-beta-N-acetylglucosaminidase H protein
  • Purity

    > 95 % SDS-PAGE.
    Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Sequence

      PAPAPVKQGPTSVAYVEVNNNSMLNVGKYTLADGGGNAFDVAVIFAANIN YDTGTKTAYLHFNENVQRVLDNAVTQIRPLQQQGIKVLLSVLGNHQGAGF ANFPSQQAASAFAKQLSDAVAKYGLDGVDFDDEYAEYGNNGTAQPNDSSF VHLVTALRANMPDKIISLYNIGPAASRLSYGGVDVSDKFDYAWNPYYGTW QVPGIALPKAQLSPAAVEIGRTSRSTVADLARRTVDEGYGVYLTYNLDGG DRTADVSAFTRELYGSEAVRTP
    • Predicted molecular weight

      29 kDa
    • Amino acids

      42 to 313

Specifications

Our Abpromise guarantee covers the use of ab151904 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.00
    Constituents: 97% Phosphate Buffer, 2.92% Sodium chloride

General Info

  • Alternative names

    • DI N Acetylchitobiosyl Beta N Acetylglucosaminidase H
    • Endo H
    • Endoglycosidase H
    • Mannosyl Glycoprotein Endo Beta N Acetyl Glucosaminidase H
  • Relevance

    Endo-beta-N-acetylglucosaminidase H belongs to the glycosyl hydrolase 18 family. Function: Cleaves asparagine-linked oligomannose and hybrid, but not complex, oligosaccharides from glycoproteins. Catalytic activity: Endohydrolysis of the N,N'-diacetylchitobiosyl unit in high-mannose glycopeptides and glycoproteins containing the -(Man(GlcNAc)2)Asn-structure. One N-acetyl-D-glucosamine residue remains attached to the protein; the rest of the oligosaccharide is released intact.

References

ab151904 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab151904.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up