Recombinant Envelope Glycoprotein (His tag) (ab220456)

Description

  • Product name

    Recombinant Envelope Glycoprotein (His tag)
    See all Envelope Glycoprotein proteins and peptides
  • Purity

    > 85 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Sequence

      IPLGVIHNSTLQVSDVDKLVCRDKLSSTNQLRSVGLNLEGNGVATDVPSA TKRWGFRSGVPPKVVNYEAGEWAENCYNLEIKKPDGSECLPAAPDGIRGF PRCRYVHKVSGTGPCAGDFAFHKEGAFFLYDRLASTVIYRGTTFAEGVVA FLILPQAKKDFFSSHPLREPVNATEDPSSGYYSTTIRYQATGFGTNETEY LFEVDNLTYVQLESRFTPQFLLQLNETIYTSGKRSNTTGKLIWKVNPEID TTIGEWAFWETKKNLTRKIRSEELSFTAVSNRAKNISGQSPARTSSDPGT NTTTEDHKIMASENSSAMVQVHSQGREAAVSHLTTLATISTSPQPPTTKP GPDNSTHNTPVYKLDISEATQVEQHHRRTDNDSTASDTPPATTAAGPLKA ENTNTSKGTDLLDPATTTSPQNHSETAGNNNTHHQDTGEESASSGKLGLI TNTIAGVAGLITGGRRARREAIVNAQPKCNPNLHYWTTQDEGAAIGLAWI PYFGPAAEGIYTEGLMHNQDGLICGLRQLANETTQALQLFLRATTELRTF SILNRKAIDFLLQRWGGTCHILGPDCCIEPHDWTKNITDKIDQIIHDFVD KTLPD
    • Predicted molecular weight

      67 kDa including tags
    • Amino acids

      33 to 637
    • Tags

      His tag C-Terminus
    • Additional sequence information

      Ebolavirus EBOV (subtype Zaire,strain Kikwit-95)

Specifications

Our Abpromise guarantee covers the use of ab220456 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 5% Trehalose, 95% PBS

    Lyophilized from 0.22 µm filtered solution.
    5-10% trehalose is commonly used for freeze drying, and after reconstitution, the trehalose is mostly about 3-5%

  • Reconstitution
    Reconstitute the lyophilized product in sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • GP
    • GP 1,2
    • GP1
    • GP2
    • GP2-delta
    • Spike glycoprotein
    • Virion spike glycoprotein
    see all
  • Cellular localization

    Virion membrane; Peripheral membrane protein.

Images

  • SDS-PAGE using ab220456. DTT-reduced protein migrates as 21-23 kDa (GP2-delta) and 110-120 kDa (GP1) in SDS-PAGE .

References

ab220456 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220456.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up