Overview

  • Product name

    Recombinant fdhA protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Bacteria
    • Sequence

      MHHHHHHSGNRGVVYLGSGKVEVQKIDYPKMQDPRGKKIEHGVILKVVST NICGSDQHMVRGRTTAQVGLVLGHEITGEVIEKGRDVENLQIGDLVSVPF NVACGRCRSCKEMHTGVCLTVNPARAGGAYGYVDMGDWTGGQAEYLLVPY ADFNLLKLPDRDKAMEKIRDLTCLSDILPTGYHGAVTAGVGPGSTVYVAG AGPVGLAAAASARLLGAAVVIVGDLNPARLAHAKAQGFEIADLSLDTPLH EQIAALLGEPEVDCAVDAVGFEARGHGHEGAKHEAPATVLNSLMQVTRVA GKIGIPGLYVTEDPGAVDAAAKIGSLSIRFGLGWAKSHSFHTGQTPVMKY NRALMQAIMWDRINIAEVVGVQVISLDDAPRGYGEFDAGVPKKFVIDPHK TFSAA
    • Molecular weight

      43 kDa including tags
    • Amino acids

      2 to 399
    • Tags

      His tag N-Terminus
    • Additional sequence information

      From Pseudomonas putida. Genbank: D21201

Specifications

Our Abpromise guarantee covers the use of ab198463 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Specific Activity: ≥35 µmol/min/µg
    Assay Conditions: The reaction was monitored by measuring NADH production by following absorbance at 340nm at room temperature for 5min. Buffer: pH 7.3, 20 mM Tris, 50 mM NaCl, 20 µM Fe2+, 500 mM a-ketoglutarate, 2 mM ascorbic acid, 0.01% Tween-20, and 1 mM NAD+.

  • Applications

    SDS-PAGE

    Functional Studies

  • Purity

    > 74 % SDS-PAGE.

  • Form

    Liquid
  • Additional notes

    Useful for the study of enzyme kinetics, screening inhibitors, and selectivity profiling.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Preservative: 1.36% Imidazole
    Constituents: 0.63% Tris HCl, 0.64% Sodium chloride, 0.02% Potassium chloride, 20% Glycerol

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • Glutathione-independent formaldehyde dehydrogenase
  • Relevance

    Catalyzes the NAD+-dependent oxidation of formaldehyde and acetoaldehyde as well as long-chain alcohols but is inactive against propionaldehyde, butyraldehyde, methanol and ethanol. Can also catalyze the dismutation of a wide range of aldehydes such as formaldehyde.

Images

  • 4-20% SDS-PAGE analysis of ab198463 with Coomassie staining.

    Lane 1: 2.88 µg ab198463
    Lane 2: Protein marker

  • Kinetics of ab198463.

References

ab198463 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab198463.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up