Description

  • Product name

    Recombinant Firefly Luciferase protein
  • Purity

    > 90 % SDS-PAGE.
    ab100961 is purified using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMMEDAKNIKKGPAPFYPLEDGTAGEQLHKA MKRYALVPGTIAFTDAHIEVDITYAEYFEMSVRLAEAMKRYGLNTNHRIV VCSENSLQFFMPVLGALFIGVAVAPANDIYNERELLNSMGISQPTVVFVS KKGLQKILNVQKKLPIIQKIIIMDSKTDYQGFQSMYTFVTSHLPPGFNEY DFVPESFDRDKTIALIMNSSGSTGLPKGVALPHRTACVRFSHARDPIFGN QIIPDTAILSVVPFHHGFGMFTTLGYLICGFRVVLMYRFEEELFLRSLQD YKIQSALLVPTLFSFFAKSTLIDKYDLSNLHEIASGGAPLSKEVGEAVAK RFHLPGIRQGYGLTETTSAILITPEGDDKPGAVGKVVPFFEAKVVDLDTG KTLGVNQRGELCVRGPMIMSGYVNNPEATNALIDKDGWLHSGDIAYWDED EHFFIVDRLKSLIKYKGYQVAPAELESILLQHPNIFDAGVAGLPDDDAGE LPAAVVVLEHGKTMTEKEIVDYVASQVTTAKKLRGGVVFVDEVPKGLTGK LDARKIREILIKAKKGGKIAV
    • Predicted molecular weight

      63 kDa including tags
    • Amino acids

      1 to 550
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab100961 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.0154% DTT, 0.316% Tris HCl, 10% Glycerol

General Info

  • Alternative names

    • ec 1.13.12.7
    • Firefly
    • Luciferase
    • Luciferin 4 monooxygenase
  • Relevance

    Luciferase from the firefly has become one of the more widely used reporter proteins for the study of gene expression. Luciferase catalyzes a bioluminescent reaction which requires the substrate luciferin as well as Mg2+ and ATP. Mixing these reagents with the cell extract containing luciferase, results in a flash of light that decays rapidly. This light can be detected by a luminometer. The total light emission is proportional to the luciferase activity of the sample.
  • Cellular localization

    Peroxisome

Images

  • 15% SDS-PAGE showing ab100691 (3 µg) at approximately 62.9 kDa.

References

This product has been referenced in:

  • Schips TG  et al. Thrombospondin-3 augments injury-induced cardiomyopathy by intracellular integrin inhibition and sarcolemmal instability. Nat Commun 10:76 (2019). Read more (PubMed: 30622267) »
  • Abaandou L & Shiloach J Knocking out Ornithine Decarboxylase Antizyme 1 (OAZ1) Improves Recombinant Protein Expression in the HEK293 Cell Line. Med Sci (Basel) 6:N/A (2018). Read more (PubMed: 29890687) »
See all 2 Publications for this product

Customer reviews and Q&As

1-2 of 2 Abreviews or Q&A

Answer

Thank you for contacting us.

Our EasyLink conjugation kits are used to conjugate prepared enzymatic, fluorescent or biotin/streptavidin conjugates to antibodies.

https://www.abcam.com/index.html?pageconfig=resource&rid=13148#enzymatic

Currently we do not carry a luciferase conjugation kit. The firefly luciferase protein ab100961 has not been prepared with the correct chemistry to be used with a conjugation kit so it won't work, unfortunately.

I am sorry thatthis informationcould not be morehelpful. Please do not hesitate to contact us if you need any more advice or information.

Use our products? Submit an Abreview. Earn rewards!
https://www.abcam.com/abreviews

Read More

Answer

Thank you for your inquiry. The MSDS is linked to each online datasheet where the product requires one.  It is on the right hand side of the page under the shipping and pricing information (under the "Datasheet PDF" link). For ab290: https://www.abcam.com/assets/popups/popup_msds.cfm?intMSDSID=3 The secondary ab97051 and protein ab100961 do not require an MSDS as these are non-hazardous products.  Please let me know if you require a statement confirming this. I hope this information helps.  Please contact us with any other questions.

Read More

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up