Recombinant Flagellin A protein (Tagged) (ab238381)

Description

  • Product name

    Recombinant Flagellin A protein (Tagged)
  • Purity

    > 85 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Sequence

      GQAISNGNDALGILQTADKAMDEQLKILDTIKTKATQAAQDGQSLKTRTM LQADINRLMEELDNIANTTSFNGKQLLSGNFINQEFQIGASSNQTVKASI GATQSSKIGLTRFETGSRISVGGEVQFTLKNYNGIDDFKFQKVVISTSVG TGLGALADEINKNADKTGVRATFTVETRGMGAVRAGATSDDFAINGVKIG KVDYKDGDANGALVSAINSVKDTTGVEASIDENGKLLLTSREGRGIKIEG NIGRGAFINPNMLENYGRLSLVKNDGKDILISGTNLSAIGFGTGNMISQA SVSLRESKGQIDANVADAMGFNSANKGNILGGYSSVSAYMSSTGSGFSSG SGFSVGSGKNYSTGFANTIAISAASQLSAVYNVSAGSGFSSGSNLSQFAT MKTSAGNTLGVKDETAGVTTLKGAMAVMDIAETAITNLDQIRADIGSVQN QVTSTINNITVTQ
    • Predicted molecular weight

      68 kDa including tags
    • Amino acids

      65 to 524
    • Additional sequence information

      Campylobacter jejuni. N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Specifications

Our Abpromise guarantee covers the use of ab238381 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, Glycerol

Images

  • ab238381 analyzed by (Tris-Glycine gel) discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

References

ab238381 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab238381.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up