Recombinant Gingipain R1 protein (His tag) (ab225982)

Overview

Description

  • Nature

    Recombinant
  • Source

    Yeast
  • Amino Acid Sequence
    • Accession
    • Species

      Porphyromonas gingivalis
    • Sequence

      YTPVEEKQNGRMIVIVAKKYEGDIKDFVDWKNQRGLRTEVKVAEDIASPV TANAIQQFVKQEYEKEGNDLTYVLLVGDHKDIPAKITPGIKSDQVYGQIV GNDHYNEVFIGRFSCESKEDLKTQIDRTIHYERNITTEDKWLGQALCIAS AEGGPSADNGESDIQHENVIANLLTQYGYTKIIKCYDPGVTPKNIIDAFN GGISLVNYTGHGSETAWGTSHFGTTHVKQLTNSNQLPFIFDVACVNGDFL FSMPCFAEALMRAQKDGKPTGTVAIIASTINQSWASPMRGQDEMNEILCE KHPNNIKRTFGGVTMNGMFAMVEKYKKDGEKMLDTWTVFGDPSLLVRTLV PTKMQVTAPAQINLTDASVNVSCDYNGAIATISANGKMFGSAVVENGTAT INLTGLTNESTLTLTVVGYNKETVIKTINTNGEPNPYQPVSNLTATTQGQ KVTLKWDAPSTKTNATTNTARSVDGIRELVLLSVSDAPELLRS
    • Molecular weight

      56 kDa including tags
    • Amino acids

      228 to 720
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab225982 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    LC-MS/MS
  • Purity

    > 90 % SDS-PAGE.

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: 50% Glycerol, Tris buffer

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis of ab225982 with 5% enrichment gel and 15% separation gel.

  • Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS analysis result of ab225982 could indicate that this peptide derived from Yeast-expressed Porphyromonas gingivalis Gingipain R1.

  • Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS analysis result of ab225982 could indicate that this peptide derived from Yeast-expressed Porphyromonas gingivalis Gingipain R1.

References

ab225982 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab225982.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up