Overview

Description

  • Nature

    Recombinant
  • Source

    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Sequence

      EGVQTCEEVRKLFQWRLLGAVRGLPDSPRAGPDLQVCISKKPTCCTRKME ERYQIAARQD MQQFLQTSSSTLKFLISRNAAAFQETLETLIKQAENYTSILFCSTYRNMA LEAAASVQEF FTDVGLYLFGADVNPEEFVNRFFDSLFPLVYNHLINPGVTDSSLEYSECI RMARRDVSPF GNIPQRVMGQMGRSLLPSRTFLQALNLGIEVINTTDYLHFSKECSRALLK MQYCPHCQGL ALTKPCMGYCLNVMRGCLAHMAELNPHWHAYIRSLEELSDAMHGTYDIGH VLLNFHLLVN DAVLQAHLNGQKLLEQVNRICGRPVRTPTQSPRCSFDQSKEKHGMKTTTR NSEETLANRR KEFINSLRLYRSFYGGLADQLCANELAAADGLPCWNGEDIVKSYTQRVVG NGIKAQSGNP EVKVKGIDPVINQIIDKLKHVVQLLQGRSPKPDKWELLQLGSGGGMVEQV SGDCDDEDGC GGSGSGEVKRTLKITDWMPDDMNFSDVKQIHQTDTGSTLDTTGAGCAVAT VDHHHHHH
    • Molecular weight

      57 kDa
    • Amino acids

      25 to 529
    • Tags

      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab151669 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 95 % SDS-PAGE.
    Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. After reconstitution store at -20ºC. Avoid freeze / thaw cycles.

    pH: 7.20
    Constituents: 99.18% Phosphate Buffer, 0.88% Sodium chloride

  • Reconstitution
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

General Info

  • Alternative names

    • bA93M14.1
    • glypican 5
    • Glypican 5 precursor
    • glypican proteoglycan 5
    • Glypican-5
    • GPC5
    • GPC5_HUMAN
    • Secreted glypican-5
    see all
  • Function

    Cell surface proteoglycan that bears heparan sulfate.
  • Tissue specificity

    In adult, primarily expressed in the brain. Also detected in fetal brain, lung and liver.
  • Sequence similarities

    Belongs to the glypican family.
  • Cellular localization

    Cell membrane and Secreted > extracellular space.
  • Information by UniProt

References

ab151669 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab151669.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up