Recombinant hamster PCSK9 protein (Active) (ab221332)

Overview

  • Product name

    Recombinant hamster PCSK9 protein (Active)
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species

      Hamster
    • Sequence

      QDEDAEYEELMLALRSQEDGLAEEEAPHVATAPFHRCSKEAWRLPGTYIV VLIDGAQRLQIEQTIHRLQTQAARRGYVIKVLDIFYDILPGFVVKMSSDL LDLALKLPHVKYIEEDSLVFGQSIPWNLDRIIPAGRQAQEYSSSNGSGQV EVYLLDTSIQSDHREIEGRVTITDFNSVPEEDGTRFHRQASKCDSHGTHL AGVVSGRDAGVAKGTILHSLRVLNCQGKGTVSGTLIGLEFIWKSQLIQPS GPLVVLLPLAGRYSRILNTACQHLASNGVVLVAAAGNFRDDACLYSPASA PEVITVGATDVQDQPVTLGTLGTNFGRCVDLFAPGKDIIGASSDCSTCFM SQSGTSQAAAHVAGIVVTMLTLEPELTLAELRQRLIHFSTKDVINMAWFP EDQRVLTPNLVATMPPKTHGTGLVAGGQLLCRTVWSAHSGPTRTATATAR CAPGEELLSCSSFSRSGRRRGDRIEAIGGQQVCKAFNAFGGEGVYAVARC CLLPRANCSTHTTPAARTSLGTHVHCHQKDHVLTGCSFHWEVEGIGVQRW AVLRSRHQPGQCIGHREASAHASCCHAPGLDCKIKEHGISGPAEQVTVAC EAGWTLTGCNVLPGAFMTLGAYAVDNMCVARSCATDTAGRTSEEAIVAAA ICCRSRPSAKAS
    • Molecular weight

      73 kDa including tags
    • Amino acids

      30 to 691
    • Tags

      His tag C-Terminus
    • Additional sequence information

      This product is for the mature full length protein. The signal peptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab221332 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Measured by its binding ability in a functional ELISA against immobilized Human LDL R (High Purity) Protein, Strep Tag, (0.5 μg/well). The linear range is 6-50 ng/mL.

  • Applications

    SDS-PAGE

    Functional Studies

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 95 % SDS-PAGE.

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 95% PBS, 5% Trehalose

    Lyophilized from 0.22 µm filtered solution.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized protein in sterile deionized water to a final concentration of 1mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

Images

  • Immobilized Human LDL R (High Purity) Protein, Strep Tag at 5 μg/mL (100 μl/well) can bind ab221332 with a linear range of 6-50 ng/mL.

  • SDS-PAGE analysis of reduced ab221332 stained overnight with Coomassie Blue.

    The reducing protein migrates as 18 kDa and 65 kDa in SDS-PAGE due to glycosylation and proteolytic digestion.

References

ab221332 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab221332.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up