Recombinant Helicobacter pylori CagA protein (Tagged) (ab224836)
Key features and details
- Expression system: Escherichia coli
- Purity: > 90% SDS-PAGE
- Tags: His tag N-Terminus
- Suitable for: MS, SDS-PAGE
Description
-
Product name
Recombinant Helicobacter pylori CagA protein (Tagged) -
Purity
> 90 % SDS-PAGE. -
Expression system
Escherichia coli -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Helicobacter pylori -
Sequence
KVNAKIDRLNQIASGLGVVGQAAGFPLKRHDKVDDLSKVGLSRNQELAQK IDNLNQAVSEAKAGFFGNLEQTIDKLKDSTKHNPMNLWVESAKKVPASLS AKLDNYATNSHIRINSNIKNGAINEKATGMLTQKNPEWLKLVNDKIVAHN VGSVPLSEYDKIGFNQKNMKDYSDSFKFSTKLNNAVKDTNSGFTQFLTNA FSTASYYCLARENAEHGIKNVNTKGGFQKS -
Predicted molecular weight
41 kDa including tags -
Amino acids
918 to 1147 -
Tags
His tag N-Terminus -
Additional sequence information
6xHis-SUMO tag at the N-terminus.
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab224836 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Mass Spectrometry
SDS-PAGE
-
Mass spectrometry
LC-MS/MS -
Form
Liquid -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
pH: 7.2
Constituents: 50% Glycerol (glycerin, glycerine), Tris buffer
General Info
-
Alternative names
- 120 kDa protein
- CAG pathogenicity island protein 26
- cag26
see all -
Relevance
It is known that H. pylori strains exhibit a significant degree of diversity. The great variability in the H. pylori genome may explain why not all infected individuals suffer from ulcer. Some H. pylori strains contain particular pathogenic genes such as cytokine associated gene A (CagA), while others lack these genes. The CagA protein of H. pylori has been found to be associated with more severe clinical manifestations, such as ulcer disease and gastric cancer. Thus, discrimination between potentially virulent strains may be relevant.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis of ab224836 with 5% enrichment gel and 15% separation gel.
-
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of ab224836 could indicate that this peptide derived from E.coli-expressed Helicobacter pylori (Campylobacter pylori) cagA.
-
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of ab224836 could indicate that this peptide derived from E.coli-expressed Helicobacter pylori (Campylobacter pylori) cagA.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
SDS download
-
Datasheet download
References (2)
ab224836 has been referenced in 2 publications.
- Zhong X et al. Cytotoxin-Associated Gene A-Positive Helicobacter pylori Promotes Autophagy in Colon Cancer Cells by Inhibiting miR-125b-5p. Can J Infect Dis Med Microbiol 2021:6622092 (2021). PubMed: 33791049
- Liu B et al. HP-CagA+ Regulates the Expression of CDK4/CyclinD1 via reg3 to Change Cell Cycle and Promote Cell Proliferation. Int J Mol Sci 21:N/A (2019). PubMed: 31905669