Recombinant Hepatitis B virus Protein X (His tag) (ab236464)

Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Hepatitis B virus
    • Sequence

      MRGSHHHHHHGSAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPS PSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQVL PKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRH KLVCSPAPCNFFTSA
    • Molecular weight

      18 kDa including tags
    • Amino acids

      2 to 154
    • Tags

      His tag N-Terminus
    • Additional sequence information

      Hepatitis B virus genotype C subtype adr (strain Japan/adr4/1983) (HBV-C).

Specifications

Our Abpromise guarantee covers the use of ab236464 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Endotoxin level

    < 1.000 Eu/µg
  • Mass spectrometry

    LC-MS/MS
  • Purity

    > 90 % SDS-PAGE.
    Purity as determined by densitometric image analysis: >90%. Protein quantified by BCA.
  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at Room Temperature. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 4
    Constituent: 5% Trehalose

    50 mM Acetate buffer. (0.4 µm filtered).

  • Reconstitution
    Add 0.1 M acetate buffer pH 4.0 to prepare a working stock solution of approximately 0.5 mg/ml and let the lyophilized pellet dissolve completely. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at –80°C for long term storage. Reconstituted protein can be stored at 4°C for one week.

General Info

  • Alternative names

    • HBx
    • Peptide X
    • Protein X
    • pX
    • X
    see all
  • Relevance

    Protein X from Hepatitis B virus genotype C subtype adr (strain Japan/adr4/1983) (HBV-C). Multifunctional protein that may modulate protein degradation pathways, apoptosis, transcription, signal transduction, cell cycle progress, and genetic stability by directly or indirectly interacting with hosts factors. Does not seem to be essential for HBV infection. May be directly involved in development of cirrhosis and liver cancer (hepatocellular carcinoma). Most of cytosolic activities involve modulation of cytosolic calcium. The effect on apoptosis is controversial depending on the cell types in which the studies have been conducted. By binding to human DDB1, may affect cell viability and stimulate genome replication. May induce apoptosis by localizing in mitochondria and causing loss of mitochondrial membrane potential. May also modulate apoptosis by binding human CFLAR, a key regulator of the death-inducing signaling complex (DISC). Moderately stimulates transcription of many different viral and cellular transcription elements. Promoters and enhancers stimulated by HBx contain DNA binding sites for NF-kappa-B, AP-1, AP-2, c-EBP, ATF/CREB, or the calcium-activated factor NF-AT. May bind bZIP transcription factors like CREB1
  • Cellular localization

    Host cytoplasm. Host nucleus. Host mitochondrion

References

ab236464 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236464.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up