Description

  • Product name

    Recombinant Hepatitis C Virus Core 2a protein (Tagged)
    See all Hepatitis C Virus Core 2a proteins and peptides
  • Biological activity

    Specific Activity: 93 pmole/min/μg

    Assay conditions: Assay was done in 100 μl HCV assay buffer containing 50 mM Tris, pH7.4, 150 mM NaCl, 5 mM DTT, 10% glycerol, and 5 μM HCV substrate peptide. Reaction was monitored at room temperature for 20 min continuously at ex350/em500.

  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Sequence

      MDYKDDDDKHHHHHHGCVSIIGRLHVNGSGSITAYAQQTRGLLGAIVVSM TGRDRTEQAGEVQILSTVSQSFLGTTISGVLWTVYHGAGNKTLAGLRGPV TQMYSSAEGDLVGWPSPPGTKSLEPCKCGAVDLYLVTRNADVIPARRRGD KRGALLSPRPISTLKGSSGGPVLCPRGHVVGLFRAAVCSRGVAKSIDFIP VETLDVVTRS
    • Predicted molecular weight

      22 kDa including tags
    • Tags

      His-DDDDK tag N-Terminus
    • Additional sequence information

      Fusion protein of amino acids 21-32 of NS4A, linker (4 amino acids) and amino acids 3-181 of NS3.

Specifications

Our Abpromise guarantee covers the use of ab198063 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.63% Tris HCl, 2.32% Sodium chloride, 0.2% Triton-X-100, 0.08% Beta mercaptoethanol, 30% Glycerol

    100 µg/mL DDDDK peptide

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • Genome polyprotein
    • HCV 2a
    • HCV core 2a
    • HCV Core genotype 2a
    • HCV2a
    • Hepatitis C Virus Core genotype 2a
    see all
  • Relevance

    HCV (Hepatitis C Virus) viral core protein forms the internal viral coat that encapsidates the genomic RNA and is enveloped in a host cell-derived lipid membrane. The hepatitis C virus (HCV) core protein represents the first 177 amino acids of the viral precursor polyprotein and is cotranslationally inserted into the membrane of the endoplasmic reticulum. The N terminus of the core protein is involved in transcriptional repression. There are over 20 different subtypes of Hepatitis C Virus; the preponderance and distribution of HCV genotypes varies globally. HCV Genotype information is important because of the role it plays in predicting HCV medical treatment response and treatment duration. Sustained cure rates (sustained viral response) of 75% or better occur in people with genotypes HCV 2 and 3 in 24 weeks of treatment. Genotypes 1a and 1b, the most prevalent worldwide, have the poorest rates of response to the present treatment regimen, which is a combination of pegylated alfa interferon 2b with ribavirin. HCV core protein is among the most conserved proteins in HCV and is known to induce sensitization of cytotoxic T lymphocytes (CTL). Therefore, it is a prime candidate for a component of a potential HCV vaccine.

Images

  • Activity assay using ab198063

  • 4-20% SDS-PAGE analysis of 2 µg ab198063 with Coomassie staining.

References

ab198063 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab198063.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up