Recombinant Hepatitis C Virus Hepatitis C Virus 1b core antigen protein (ab198152)

Description

  • Product name

    Recombinant Hepatitis C Virus Hepatitis C Virus 1b core antigen protein
    See all Hepatitis C Virus 1b core antigen proteins and peptides
  • Purity

    >= 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Hepatitis C virus
    • Sequence

      MDYKDDDDKHHHHHHGSVVIVGRIILSGSGSITAYSQQTRGVLGCIITSL TGRDKNQVEGEVQVVSTATQSFLATCINGVCWTVYHGAGSKTLAGPKGPI TQMYTNVDLDLVGWQAPPGARSMTPCSCGSSDLYLVTRHADVIPVRRRGD SRGSLLSPRPVSYLKGSSGGPLLCPSGHVVGVFQAAVCTRGVAKAVDFIP VESMETTMRS
    • Predicted molecular weight

      22 kDa including tags
    • Modifications

      mutated R155 Q
    • Tags

      His-DDDDK tag N-Terminus
    • Additional sequence information

      Fusion protein is serine protease NS3 (aa 3-181) and cofactor NS4A (aa 21-32) from Hepatitis C Virus 1b core antigen (AF054247) with Arg-to-Gln mutation, tags, and a 4 aa linker. UniProt: O92972

Specifications

Our Abpromise guarantee covers the use of ab198152 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    ab198152 is useful for the study of enzyme kinetics, screening inhibitors, and selectivity profiling.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Preservative: 2.28% Imidazole
    Constituents: 0.63% Tris HCl, 0.64% Sodium chloride, 0.04% Tween, 20% Glycerol, 0.02% Potassium chloride

General Info

  • Alternative names

    • HCV strain 1b core antigen
    • HCV subtype 1b core antigen
    • HCV type 1b core antigen
    • Hepatitis C Virus 1b core antigen
  • Relevance

    HCV (Hepatitis C Virus) viral core protein forms the internal viral coat that encapsidates the genomic RNA and is enveloped in a host cell-derived lipid membrane. The hepatitis C virus (HCV) core protein represents the first 177 amino acids of the viral precursor polyprotein and is cotranslationally inserted into the membrane of the endoplasmic reticulum. The N terminus of the core protein is involved in transcriptional repression. There are over 20 different subtypes of Hepatitis C Virus; HCV type 1b is mostly mostly found in Europe and Asia. The prevalence of HCV type 1b infection has recently decreased, although it still accounts for most HCV-related cirrhosis and hepatocellular carcinoma. High HCV viremia levels and HCV genotype type 1b are independent predictors for poor response to interferon-{alpha} therapy. HCV core protein is among the most conserved proteins in HCV and is known to induce sensitization of cytotoxic T lymphocytes (CTL). Therefore, it is a prime candidate for a component of a potential HCV vaccine.

Images

  • 4-20% SDS-PAGE of Hepatitis C Virus 1b core antigen protein using 5μg of ab198152.

References

ab198152 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab198152.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up