Recombinant Hepatitis C virus Hepatitis C Virus 1b core antigen protein (ab198152)
Key features and details
- Expression system: Escherichia coli
- Purity: >= 90% SDS-PAGE
- Tags: His-DDDDK tag N-Terminus
- Suitable for: SDS-PAGE
Description
-
Product name
Recombinant Hepatitis C virus Hepatitis C Virus 1b core antigen protein
See all Hepatitis C Virus 1b core antigen proteins and peptides -
Purity
>= 90 % SDS-PAGE. -
Expression system
Escherichia coli -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Hepatitis C virus -
Sequence
MDYKDDDDKHHHHHHGSVVIVGRIILSGSGSITAYSQQTRGVLGCIITSL TGRDKNQVEGEVQVVSTATQSFLATCINGVCWTVYHGAGSKTLAGPKGPI TQMYTNVDLDLVGWQAPPGARSMTPCSCGSSDLYLVTRHADVIPVRRRGD SRGSLLSPRPVSYLKGSSGGPLLCPSGHVVGVFQAAVCTRGVAKAVDFIP VESMETTMRS -
Predicted molecular weight
22 kDa including tags -
Modifications
mutated R155Q -
Tags
His-DDDDK tag N-Terminus -
Additional sequence information
Fusion protein is serine protease NS3 (aa 3-181) and cofactor NS4A (aa 21-32) from Hepatitis C Virus 1b core antigen (AF054247) with Arg-to-Gln mutation, tags, and a 4 aa linker. UniProt: O92972
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab198152 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
-
Form
Liquid -
Additional notes
ab198152 is useful for the study of enzyme kinetics, screening inhibitors, and selectivity profiling.
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.
pH: 8.00
Preservative: 2.28% Imidazole
Constituents: 0.63% Tris HCl, 0.64% Sodium chloride, 0.04% Tween, 20% Glycerol (glycerin, glycerine), 0.02% Potassium chloride
General Info
-
Alternative names
- HCV strain 1b core antigen
- HCV subtype 1b core antigen
- HCV type 1b core antigen
- Hepatitis C Virus 1b core antigen
-
Relevance
HCV (Hepatitis C Virus) viral core protein forms the internal viral coat that encapsidates the genomic RNA and is enveloped in a host cell-derived lipid membrane. The hepatitis C virus (HCV) core protein represents the first 177 amino acids of the viral precursor polyprotein and is cotranslationally inserted into the membrane of the endoplasmic reticulum. The N terminus of the core protein is involved in transcriptional repression. There are over 20 different subtypes of Hepatitis C Virus; HCV type 1b is mostly mostly found in Europe and Asia. The prevalence of HCV type 1b infection has recently decreased, although it still accounts for most HCV-related cirrhosis and hepatocellular carcinoma. High HCV viremia levels and HCV genotype type 1b are independent predictors for poor response to interferon-{alpha} therapy. HCV core protein is among the most conserved proteins in HCV and is known to induce sensitization of cytotoxic T lymphocytes (CTL). Therefore, it is a prime candidate for a component of a potential HCV vaccine.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab198152 has not yet been referenced specifically in any publications.