Recombinant Hepatitis C virus Hepatitis C Virus E2 protein (His tag) (ab214832)
Key features and details
- Expression system: HEK 293 cells
- Purity: > 95% SDS-PAGE
- Endotoxin level: < 0.010 Eu/µg
- Tags: His tag C-Terminus
- Suitable for: SDS-PAGE
Description
-
Product name
Recombinant Hepatitis C virus Hepatitis C Virus E2 protein (His tag)
See all Hepatitis C Virus E2 proteins and peptides -
Purity
> 95 % SDS-PAGE. -
Endotoxin level
< 0.010 Eu/µg -
Expression system
HEK 293 cells -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Hepatitis C virus -
Sequence
AETHVTGGSAGRTTAGLVGLLTPGAKQNIQLINTNGSWHINSTALNCNES LNTGWLAGLFYQHKFNSSGCPERLASCRRLTDFAQGWGPISYANGSGLDE RPYCWHYPPRPCGIVPAKSVCGPVYCFTPSPVVVGTTDRSGAPTYSWGAN DTDVFVLNNTRPPLGNWFGCTWMNSTGFTKVCGAPPCVIGGVGNNTLLCP TDCFRKHPEATYSRCGSGPWITPRCMVDYPYRLWHYPCTINYTIFKVRMY VGGVEHRLEAACNWTRGERCDLEDRDRSELS -
Predicted molecular weight
31 kDa -
Amino acids
383 to 663 -
Tags
His tag C-Terminus -
Additional sequence information
Subtype 1a.
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab214832 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
-
Form
Liquid -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at -20°C.
Preservative: 0.1% Sodium azide
Constituents: 20% Glycerol, 79% PBS
General Info
-
Alternative names
- Core protein
- E1 protein
- E2 protein
see all -
Relevance
Hepatitis C E2 is a virus envelope glycoprotein which forms a heterodimer with the E1 protein. E2 inhibits human EIF2AK2/PKR activation, preventing the establishment of an antiviral state. E2 is a viral ligand for CD209/DC-SIGN and CLEC4M/DC-SIGNR, which are respectively found on dendritic cells (DCs), and on liver sinusoidal endothelial cells and macrophage-like cells of lymph node sinuses. These interactions allow capture of circulating HCV particles by these cells and subsequent transmission to permissive cells. DCs are professional antigen presenting cells, critical for host immunity by inducing specific immune responses against a broad variety of pathogens. They act as sentinels in various tissues where they entrap pathogens and convey them to local lymphoid tissue or lymph node for establishment of immunity. Capture of circulating HCV particles by these SIGN+ cells may facilitate virus infection of proximal hepatocytes and lymphocyte subpopulations and may be essential for the establishment of persistent infection. -
Cellular localization
Viral envelope protein.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab214832 has not yet been referenced specifically in any publications.