Description

  • Product name

    Recombinant hepatitis c virus Hepatitis C Virus NS3 + NS4A protein
    See all Hepatitis C Virus NS3 + NS4A proteins and peptides
  • Biological activity

    Assay Conditions: Assay was performed using 100 µl HCV assay buffer containing 50 mM Tris, pH 7.4, 150 mM NaCl, 5 mM DTT, 10% glycerol, and 5 µM fluorescently labeled HCV substrate peptide. Reaction was continuously monitored at room temperature for 20 min. at ex350/em500.

  • Purity

    >= 80 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Hepatitis C virus
    • Sequence

      MDYKDDDDKHHHHHHGSVVIVGRIILSGSGSITAYSQQTRGVLGCIITSL TGRDKNQVEGEVQVVSTATQSFLATCINGVCWTVYHGAGSKTLAGPKGPI TQMYTNVDLDLVGWQAPPGARSMTPCSCGSSDLYLVTRHADVIPVRRRGD SRGSLLSPRPVSYLKGSSGGPLLCPSGHVVGVFRAAVCTRGVAKAVDFIP VESMETTMRS
    • Predicted molecular weight

      22 kDa including tags
    • Tags

      His-DDDDK tag N-Terminus
    • Additional sequence information

      Fusion protein corresponding to the serine protease NS3 (a.a. 3-181) and cofactor NS4A (a.a. 21-32) from Hepatitis C virus genotype 1b.

Specifications

Our Abpromise guarantee covers the use of ab198093 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 2.9% Sodium chloride, 10% Glycerol, 0.02% Triton-X-100, 0.08% Beta mercaptoethanol

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

Images

  • Activity assay using ab198093.

  • 4-20% SDS-PAGE analysis of 2 µg ab198093 with Coomassie staining.

References

ab198093 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab198093.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up