Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Sequence

      MDYKDDDDKHHHHHHGSVVIVGRIILSGSGSITAYSQQTRGVLGCIITSL TGRDKNQVEGEVQVVSTATQSFLATCINGVCWTVYHGAGSKTLAGPKGPI TQMYTNVDLDLVGWQAPPGARSMTPCSCGSSDLYLVTRHADVIPVRRRGD SRGSLLSPRPVSYLKGSSGGPLLCPSGHVVGVFRAAVCTRGVAKAVVFIP VESMETTMRS
    • Molecular weight

      22 kDa including tags
    • Modifications

      mutated D168 V
    • Tags

      His-DDDDK tag N-Terminus
    • Additional sequence information

      Fusion protein of aa21-32 of NS4A, linker (4 aa) and aa3-181 of NS3 with Asp-to-Val mutation on aa168.

Specifications

Our Abpromise guarantee covers the use of ab198098 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Specific Activity: 45 pmole/min/µg.

     

    Assay Conditions: Assay was performed in 100 µl HCV assay buffer containing 50 mM Tris, pH7.4, 150 mM NaCl, 5 mM DTT, 10% glycerol, and 5 µM fluorescently labeled HCV substrate peptide. Reaction was continuously monitored at room temperature for 20 min. at ex350/em500.

  • Applications

    Functional Studies

    SDS-PAGE

  • Purity

    > 90 % SDS-PAGE.

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.63% Tris HCl, 2.32% Sodium chloride, 0.2% Triton-X-100, 0.08% Beta mercaptoethanol, 30% Glycerol

    Contains 100 µg/ml DDDDK peptide.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

Images

  • Activity assay using ab198098.

  • 4-20% SDS-PAGE analysis of 2 µg ab198098 with Coomassie staining.

References

ab198098 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab198098.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up