Recombinant Herpes simplex virus Envelope Glycoprotein (Tagged) (ab239436)

Description

  • Product name

    Recombinant Herpes simplex virus Envelope Glycoprotein (Tagged)
    See all Envelope Glycoprotein proteins and peptides
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Herpes simplex virus
    • Sequence

      STEYVIRSRVAREVGDILKVPCVPLPSDDLDWRYETPSAINYALIDGIFL RYHCPGLDTVLWDRHAQKAYWVNPFLFVAGFLEDLSHPAFPANTQETETR LALYKEIRQALDSRKQAASHTPVKAGCVNFDYSRTRRCVGRQDLGPTNGT SGRTPVLPPDDEAGLQPKPLTTPPPIIATSDPTPRRDAATKSRRRRPHSR RL
    • Predicted molecular weight

      43 kDa including tags
    • Amino acids

      23 to 224
    • Additional sequence information

      Full-length mature chain lacking the signal peptide. N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged.

Specifications

Our Abpromise guarantee covers the use of ab239436 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    LC-MS/MS
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names

    • GP
    • GP 1,2
    • GP1
    • GP2
    • GP2-delta
    • Spike glycoprotein
    • Virion spike glycoprotein
    see all
  • Cellular localization

    Virion membrane; Peripheral membrane protein.

Images

  • ab239436 analyzed by (Tris-Glycine gel) discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of ab239436 could indicate that this peptide derived from E.coli-expressed Human herpesvirus 1 (strain KOS) (HHV-1) (Human herpes simplex virus 1)  Envelope Glycoprotein.

  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of ab239436 could indicate that this peptide derived from E.coli-expressed Human herpesvirus 1 (strain KOS) (HHV-1) (Human herpes simplex virus 1) Envelope Glycoprotein.

References

ab239436 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab239436.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up