Description

  • Product name

    Recombinant Herpes simplex virus HSV2 gB protein (His tag)
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Herpes simplex virus
    • Sequence

      APAAPAAPRASGGVAATVAANGGPASRPPPVPSPATTKARKRKTKKPPKR PEATPPPDANATVAAGHATLRAHLREIKVENADAQFYVCPPPTGATVVQF EQPRRCPTRPEGQNYTEGIAVVFKENIAPYKFKATMYYKDVTVSQVWFGH RYSQFMGIFEDRAPVPFEEVIDKINTKGVCRSTAKYVRNNMETTAFHRDD HETDMELKPAKVATRTSRGWHTTDLKYNPSRVEAFHRYGTTVNCIVEEVD ARSVYPY
    • Predicted molecular weight

      44 kDa including tags
    • Amino acids

      23 to 279
    • Tags

      His tag N-Terminus
    • Additional sequence information

      Human herpesvirus 2 (strain HG52) (HHV-2) (Human herpes simplex virus 2). 6xHis-SUMO tag at the N-terminus

Specifications

Our Abpromise guarantee covers the use of ab225600 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: 50% Glycerol, Tris buffer

General Info

  • Alternative names

    • GB
    • Glycoprotein B
    • Herpes simplex virus 2 glycoprotein B
    • HSVII gB
    • Human Herpesvirus 2
    • UL27
    see all
  • Relevance

    Herpes simplex type 2 (HSV-2) belongs to a family that includes HSV-1, Epstein-Barr virus (EBV) and Varicella zoster (chicken pox) virus. HSV-1 and HSV-2 are extremely difficult to distinguish from each other. These viruses have a DNA genome, an icosahedral protein coat and are encased in a lipid membrane derived from the nuclear membrane of the last host. These viruses are capable of entering a latent phase where the host shows no visible sign of infection and levels of infectious agent become very low. During the latent phase the viral DNA is integrated into the genome of the host cell.

Images

  • ab225600 analysed by SDS-PAGE (Tris-Glycine with 5% enrichment gel and 15% separation gel).

References

ab225600 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab225600.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up