Description

  • Product name

    Recombinant Hirudin protein
    See all Hirudin proteins and peptides
  • Biological activity

    The specific activity was found to be >14,000ATU/mg.

  • Purity

    > 95 % SDS-PAGE.
    ab73660 is purified by proprietary chromatographic techniques. Purity is greater than 95.0% as determined by RP-HPLC and SDS-PAGE.
  • Expression system

    Pichia pastoris
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Leech
    • Sequence

      VVYTDCTESGQNLCLCEGSNVCGQGNKCILGSDGEKNQCVTGEGTPKPQS HNDGDFEEIPEEYLQ
    • Amino acids

      1 to 65
    • Additional sequence information

      Identical to natural Hirudin except for the substitution of leucine for isoleucine at the N-terminal end of the molecule and the absence of a sulfate group on the tyrosine at position 63.

Associated products

Specifications

Our Abpromise guarantee covers the use of ab73660 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.00
    Constituents: PBS, 2% Mannitol

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Reconstitute in sterile 18MO-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions. Upon reconstitution ab73660 should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.

General Info

  • Alternative names

    • Hirudin 1
    • Lepirudin
    • Refludan
  • Relevance

    Hirudin is a highly effective and very specific anticoagulant which specifically inhibits formation of fibrin and activation of factors V, VIII and XIII by forming irreversible, noncovalent 1:1 complexes with a-thrombin. Hirudin is a 65 amino acid polypeptide, 7 kDa protein naturally originating from the medical leech Hirudo medicinalis. It is the most potent thrombin inhibitor known to date.
  • Cellular localization

    Secreted

References

ab73660 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab73660.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up