Bioactive grade

Recombinant Hirudin protein (Active) (ab245193)

Description

  • Product name

    Recombinant Hirudin protein (Active)
    See all Hirudin proteins and peptides
  • Biological activity

    The biological activity is determined by chromogenic assay, 1 unit is defined as the amount of Hirudin that neutralizes 1 unit of the WHO preparation 89/588 of thrombin. The specific activity is no less than 14,000 ATU/mg protein.

  • Purity

    > 96 % SDS-PAGE.
    >96% as determined by HPLC.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Sequence

      VVYTDCTESGQNLCLCEGSNVCGQGNKCILGSDGEKNQCVTGEGTPGPQS HNDGDFEEPEEYL
    • Predicted molecular weight

      7 kDa
    • Amino acids

      1 to 63
    • Additional sequence information

      Poecilobdella viridis (Indian freshwater leech)

Specifications

Our Abpromise guarantee covers the use of ab245193 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    HPLC

    SDS-PAGE

    Functional Studies

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: Phosphate Buffer, 0.87% Sodium chloride

    0.2 µm filtered

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at -20degC. Further dilutions should be made in appropriate buffered solutions.

General Info

  • Alternative names

    • Hirudin 1
    • Lepirudin
    • Refludan
  • Relevance

    Hirudin is a highly effective and very specific anticoagulant which specifically inhibits formation of fibrin and activation of factors V, VIII and XIII by forming irreversible, noncovalent 1:1 complexes with a-thrombin. Hirudin is a 65 amino acid polypeptide, 7 kDa protein naturally originating from the medical leech Hirudo medicinalis. It is the most potent thrombin inhibitor known to date.
  • Cellular localization

    Secreted

Images

  • SDS Page analysis of Hirudin with ab245193.

References

ab245193 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab245193.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up