Description

  • Product name

    Recombinant HIV1 gp120 protein
    See all HIV1 gp120 proteins and peptides
  • Purity

    > 90 % SDS-PAGE.
    Purified under conditions that maintain the tertiary structure of the molecule. Sterile filtered solution.
  • Expression system

    Baculovirus infected insect cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Sequence

      KLWVTVYYGVPVWKEATTTLFCASDAKAYDTEVHNVWATHACVPTDPNPQ EVVLVNVTEN FNMWKNDMVEQMHEDIISLWDQSLKPCVKLTPLCVSLK CTDLKNDTNTNSSSGRMIMEKG EIKNCSFNISTSIRGKVQKEYAFFYK LDIIPIDNDTTSYKLTSCNTSVITQACPKVSFEP IPIHYCAPAGFAIL KCNNKTFNGTGPCTNVSTVQCTHGIRPVVSTQLLLNGSLAEEEVVI RS VNFTDNAKTIIVQLNTSVEINCTRPNNNTRKRIRIQRGPGRAFVTIGKIG NMRQAHCN ISRAKWNNTLKQIASKLREQFGNNKTIIFKQSSGGDPEIV THSFNCGGEFFYCNSTQLFN STWFNSTWSTEGSNNTEGSDTITLPCRI KQIINMWQKVGKAMYAPPISGQIRCSSNITGL LLTRDGGNSNNESEIF RPGGGDMRDNWRSELYKYKVVKIEPLGVAPTKAKRRVVQREKR
    • Predicted molecular weight

      54 kDa
    • Amino acids

      33 to 511
    • Additional sequence information

      Human immunodeficiency virus 1

Specifications

Our Abpromise guarantee covers the use of ab188549 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).

    ab188549 is the external envelope protein, full-length 120 kDa, derived from the env. gene of HIV-1 and glycosylated with N-linked sugars and produced using baculovirus vectors in insect cells. The gp120CM stands for Chaing Mai from Clade E and is M-tropic meaning it binds to CCR5.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C. Avoid freeze / thaw cycle. Please see notes section.

    pH: 7.60
    Constituents: 0.16% Tris HCl, 0.88% Sodium chloride, 0.01% Triton N 101

General Info

  • Alternative names

    • Glycoprotein 120
    • gp120
    • SU
    • Surface protein
  • Relevance

    HIV1 is equipped with the envelope gp160 glycoprotein for interaction with Langerhans cells (LCs) and dendritic cells (DCs), the members of the innate immune system, which confront the virus at the portal of virus entry in the human body. These cells are equipped with receptors by which they bind and endocytose the virus. The gp120 glycoprotein is used for binding to CD4 receptor and CCR5 co-receptor of T helper 2 (Th2) cells, and is able to induce FcepsilonRI(+) hematopoietic cells to produce IL4, which inactivates the host adaptive immune response.
  • Cellular localization

    Envelope surface glycoprotein.

References

ab188549 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab188549.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up