Description

  • Product name

    Recombinant HIV1 gp120 protein (Active) (Biotin)
    See all HIV1 gp120 proteins and peptides
  • Biological activity

    Immobilized Human CD4, Fc Tag at 5 μg/mL (100 μL/well) can bind ab246147 with a linear range of 0.156-1.25 μg/mL.

  • Purity

    > 95 % SDS-PAGE.
    The biotin to protein ratio is 0.5-1 as determined by the HABA assay.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      HIV-1
    • Sequence

      TVYYGVPVWKEATTTLFCASDAKAYDTEVHNVWATHACVPADPNPQEMVL ENVTENFNMWKNEMVNQMQEDVISLWDQSLKPCVKLTPLCVTLECRNVSS NSNDTYHETYHESMKEMKNCSFNATTVVRDRKQTVYALFYRLDIVPLTKK NYSENSSEYYRLINCNTSAITQACPKVTFDPIPIHYCTPAGYAILKCNDK IFNGTGPCHNVSTVQCTHGIKPVVSTQLLLNGSLAEGEIIIRSENLTNNV KTIIVHLNQSVEIVCTRPGNNTRKSIRIGPGQTFYATGDIIGDIRQAHCN ISEDKWNETLQRVSKKLAEHFQNKTIKFASSSGGDLEVTTHSFNCRGEFF YCNTSGLFNGTYTPNGTKSNSSSIITIPCRIKQIINMWQEVGRAMYAPPI KGNITCKSNITGLLLVRDGGTEPNDTETFRPGGGDMRNNWRSELYKYKVV EIKPLGVAPTTAKRRVVEREKR
    • Predicted molecular weight

      57 kDa including tags
    • Amino acids

      36 to 507
    • Tags

      His tag C-Terminus , Avi tag C-Terminus
    • Additional sequence information

      AviTag sequence GLNDIFEAQKIEWHE. HIV-1 [HIV-1/Clade B/C (CN54)] GP120.
  • Conjugation

    Biotin

Specifications

Our Abpromise guarantee covers the use of ab246147 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Lyophilised
  • Additional notes

    Biotinylation of this product is performed using Avitag™ technology. Briefly, the single lysine residue in the Avitag is enzymatically labeled with biotin.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon reconsitution add a carrier protein (0.1% BSA). Store at -20°C or -80°C. Avoid freeze / thaw cycle. Store In the Dark.

    pH: 7.40
    Constituents: PBS, 5% Trehalose

    0.22 µm filtered

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized product in sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long-term storage.

General Info

  • Alternative names

    • Glycoprotein 120
    • gp120
    • SU
    • Surface protein
  • Relevance

    HIV1 is equipped with the envelope gp160 glycoprotein for interaction with Langerhans cells (LCs) and dendritic cells (DCs), the members of the innate immune system, which confront the virus at the portal of virus entry in the human body. These cells are equipped with receptors by which they bind and endocytose the virus. The gp120 glycoprotein is used for binding to CD4 receptor and CCR5 co-receptor of T helper 2 (Th2) cells, and is able to induce FcepsilonRI(+) hematopoietic cells to produce IL4, which inactivates the host adaptive immune response.
  • Cellular localization

    Envelope surface glycoprotein.

Images

  • SDS-PAGE - HIV1 gp120 protein (Active) (Biotin) (ab246147).

    The gel was stained overnight with Coomassie Blue.

    The protein migrates as 90-116 kDa under reducing conditions due to glycosylation.

  • Immobilized Human CD4, Fc Tag at 5 μg/mL (100 μL/well) can bind ab246147 with a linear range of 0.156-1.25 μg/mL.

References

ab246147 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab246147.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up