Description

  • Product name

    Recombinant HIV1 gp120 protein (His tag)
    See all HIV1 gp120 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.

  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Sequence

      MWVTVYYGVPVWREAETTLFCASNAKAYDTEAHNVWATHACVPTDPNPQE VLLENVTENFNMWKNNMVDQMHEDIISLWDQSLKPCVKLTPLCVTLDCHN INSTLNDTQEEIRNCSFNVTTELRDKKQKVYALFYRLDVVQINNNKSSEN GSQYRLVNCNTSAITQACPKVTFEPIPIHYCAPAGFAILKCSDEDFKGTG QCKNVSTVQCTHGIKPVVSTQLLLNGSLAEKKIVIRSENITNNAKTIIVQ LDKPVRINCTRPNNNTRKSVRIGPGQTFYATGDIIGNIRQAYCNVSRTEW NKTLQKVATRLRESLGNNHTIIFNNHSGGDLEIITHSFNCGGEFFYCNTS ILFNSTWDNSTVNTNNITEPNDTITLQCRIKQIINMWQKVGQAMYAPPIK GIIRCDSNITGLLLTRDGGNNNSTNETFRPGGGDMRDNWRSELYKYKVVK IDPIGVAPTHAKRRVVEKEKRA
    • Predicted molecular weight

      54 kDa
    • Amino acids

      29 to 501
    • Additional sequence information

      6xHis-tagged gp120 (HIV-1/Subtype CRF02_AG/98US_MSC5007)

Specifications

Our Abpromise guarantee covers the use of ab217641 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Store at -20°C long term. Avoid freeze / thaw cycle.

General Info

  • Alternative names

    • Glycoprotein 120
    • gp120
    • SU
    • Surface protein
  • Relevance

    HIV1 is equipped with the envelope gp160 glycoprotein for interaction with Langerhans cells (LCs) and dendritic cells (DCs), the members of the innate immune system, which confront the virus at the portal of virus entry in the human body. These cells are equipped with receptors by which they bind and endocytose the virus. The gp120 glycoprotein is used for binding to CD4 receptor and CCR5 co-receptor of T helper 2 (Th2) cells, and is able to induce FcepsilonRI(+) hematopoietic cells to produce IL4, which inactivates the host adaptive immune response.
  • Cellular localization

    Envelope surface glycoprotein.

Images

  • SDS Page analysis of ab217641

References

ab217641 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab217641.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up