Description

  • Product name

    Recombinant HIV1 Nef protein
    See all HIV1 Nef proteins and peptides
  • Purity

    > 90 % SDS-PAGE.
    The final product was refolded using temperature shift inclusion body refolding technology and chromatographically purified.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Sequence

      MASMTGGQQMGRGHHHHHHENLYFQGGFGGKWSKSSVIGWPAVRERMRRA EPAADGVGAVSRDLEKHGAITSSNTAANNAACAWLEAQEEEEVGFPVTPQ VPLRPMTYKAAVDLSHFLKEKGGLEGLIHSQRRQDILDLWIYHTQGYFPD WQNYTPGPGVRYPLTFGWCYKLVPVEPDKVEEANKGENTSLLHPVSLHGM DDPEREVLEWRFDSRLAFHHVARELHPEYFKNC
    • Predicted molecular weight

      26 kDa including tags
    • Amino acids

      1 to 206
    • Tags

      His-T7 tag N-Terminus
    • Additional sequence information

      Derived from NL4-3 strain and constructed with codon optimization and expressed with a small T7-His-TEV cleavage site Tag (29aa) fusion at its N-terminal.

Specifications

Our Abpromise guarantee covers the use of ab185584 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituent: 0.32% Tris HCl

    Contains NaCl, KCl, EDTA, arginine, DTT and Sucrose.

General Info

  • Alternative names

    • C terminal core protein
    • F protein
    • Nef
    • Negative factor
    • p27
    see all
  • Relevance

    Nef is a early protein that appears to play a role in optimizing the host cell environment for viral replication without causing cell death by apoptosis. Nef enhances virus infectivity and pathogenicity. It down modulates surface MHC I molecules and internalized molecules are sequested to the trans-Golgi network. The number of cell surface CD4 antigen are decreased by interacting with the Src family kinase LCK thereby inducing LCK CD4 dissociation and by increasing clathrin-dependent endocytosis of this antigen to target it to lysosomal degradation.

References

This product has been referenced in:

  • Yan Q  et al. Inhibition of Kaposi's sarcoma-associated herpesvirus lytic replication by HIV-1 Nef and cellular microRNA hsa-miR-1258. J Virol 88:4987-5000 (2014). Read more (PubMed: 24554664) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab185584.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up