Description

  • Product name

    Recombinant HIV2 gp120 protein (His tag)
  • Purity

    > 95 % SDS-PAGE.

  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Sequence

      KQFVTVFYGIPAWRNASIPLFCATKNRDTWGTIQCLPDNDDYQEITLNVT EAFDAWNNTVTEQAVEDVWNLFETSIKPCVKLTPLCVAMNCTRNMTTWTG RTDTQNITIINDTSHARADNCTGLKEEEMIDCQFSMTGLERDKRKQYTEA WYSKDVVCDNNTSSQSKCYMNHCNTSVITESCDKHYWDAMRFRYCAPPGF ALLRCNDTNYSGFAPNCSKVVAATCTRMMETQTSTWFGFNGTRAENRTYI YWHGKDNRTIISLNNFYNLTMHCKRPGNKTVLPITFMSGFKFHSQPVINK KPRQAWCWFEGQWKEAMQEVKETLAKHPRYKGNRSRTENIKFKAPGRGSD PEVTYMWTNCRGESLYCNMTWFLNWVENRTGQKQRNYAPCRIRQIINTWH RVGKNLYLPPREGELTCNSTVTSIIANIDAGDQTNITFSAEAAELYRLEL GDYKLVEITPIGFAPTSVKRYSSAHQRHT
    • Predicted molecular weight

      54 kDa
    • Amino acids

      23 to 501
    • Additional sequence information

      From HIV-2 subtype A (isolate NIH-Z)

Specifications

Our Abpromise guarantee covers the use of ab217639 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Store at -20°C long term. Avoid freeze / thaw cycle.

    Constituent: 100% PBS

Images

  • SDS Page analysis of ab217639

References

ab217639 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab217639.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up