For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    recombinant-horse-ccl4mip-1-beta-protein-ab203716.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Immunology Innate Immunity Macrophage / Inflamm.
Share by email

Recombinant Horse CCL4/MIP-1 beta protein (ab203716)

  • Datasheet
Submit a review Submit a question

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Key features and details

  • Expression system: Yeast
  • Purity: > 95% SDS-PAGE
  • Suitable for: WB, ELISA

Description

  • Product name

    Recombinant Horse CCL4/MIP-1 beta protein
    See all CCL4/MIP-1 beta proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    ab203716 was purified by ion-exchange chromatography.
  • Expression system

    Yeast
  • Accession

    100057859
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Equus
    • Sequence

      APMGSDPPTACCFSYTLRKLPRNFVVDYYETSSLCSQPAVVFQTKKGRQV CANPSDDWVQEYMDDLELN
    • Predicted molecular weight

      8 kDa
    • Amino acids

      24 to 92
    • Additional sequence information

      This product is for the mature full length protein from aa 24 to 92. The signal peptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab203716 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Lyophilized
  • Additional notes

     This product was previously labelled as Macrophage Inflammatory Protein 1 beta, MIP1 beta

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C. Avoid freeze / thaw cycle.

    Constituents: 90% PBS, 10% Trehalose

  • Reconstitution
    Reconstitute with sterile PBS containing at least 0.1% carrier protein.

General Info

  • Alternative names

    • MIP 1 beta
    • Secreted protein G 26
    • ACT 2
    • ACT-2
    • ACT2
    • AT744.1
    • AT744.2
    • C C motif chemokine 4
    • C C motif chemokine 4 like
    • C C motif chemokine ligand 4 like 1
    • C C motif chemokine ligand 4 like 2
    • CC chemokine ligand 4
    • CC chemokine ligand 4L1
    • CC chemokine ligand 4L1d2
    • CC chemokine ligand 4L2
    • CCL4
    • CCL4_HUMAN
    • CCL4L
    • ccl4l 1
    • CCL4L1
    • Chemokine (C C motif) ligand 4
    • Chemokine (C C motif) ligand 4 like 1
    • Chemokine (C C motif) ligand 4 like 1, telomeric
    • Chemokine (C C motif) ligand 4 like 2
    • Chemokine CC Motif Ligand 4
    • G 26
    • G 26 T lymphocyte secreted protein
    • G-26 T-lymphocyte-secreted protein
    • HC21
    • Immune activation 2
    • LAG 1
    • LAG-1
    • LAG1
    • Lymphocyte activation gene 1
    • Lymphocyte activation gene 1 protein
    • Macrophage inflammatory protein 1 beta
    • Macrophage inflammatory protein 1-beta
    • Macrophage inflammatory protein 1b2
    • MGC104418
    • MGC126025
    • MGC126026
    • MIP-1-beta
    • MIP-1-beta(1-69)
    • MIP-1-beta(3-69)
    • MIP1 beta
    • MIP1B
    • MIP1B1
    • Monocyte adherence induced protein 5 alpha
    • PAT 744
    • Protein H400
    • SCYA2
    • SCYA4
    • SCYA4L
    • SCYA4L1
    • SCYA4L2
    • SCYQ4L2
    • Secreted protein G 26
    • Secreted protein G26
    • SIS gamma
    • SIS-gamma
    • Small inducible cytokine A4
    • Small inducible cytokine A4 (homologous to mouse Mip 1b)
    • small inducible cytokine A4-like
    • Small-inducible cytokine A4
    • T cell activation protein 2
    • T-cell activation protein 2
    see all
  • Function

    Monokine with inflammatory and chemokinetic properties. Binds to CCR5. One of the major HIV-suppressive factors produced by CD8+ T-cells. Recombinant MIP-1-beta induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV). The processed form MIP-1-beta(3-69) retains the abilities to induce down-modulation of surface expression of the chemokine receptor CCR5 and to inhibit the CCR5-mediated entry of HIV-1 in T-cells. MIP-1-beta(3-69) is also a ligand for CCR1 and CCR2 isoform B.
  • Sequence similarities

    Belongs to the intercrine beta (chemokine CC) family.
  • Post-translational
    modifications

    N-terminal processed form MIP-1-beta(3-69) is produced by proteolytic cleavage after secretion from peripheral blood lymphocytes.
  • Cellular localization

    Secreted.
  • Target information above from: UniProt accession P13236 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

Protocols

To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

Click here to view the general protocols

Datasheets and documents

    • Datasheet
  • References (0)

    Publishing research using ab203716? Please let us know so that we can cite the reference in this datasheet.

    ab203716 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab203716.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2021 Abcam plc. All rights reserved.