Description

  • Product name

    Recombinant Horse IL-13 protein
    See all IL-13 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    Ion-exchange chromatography.
  • Expression system

    Yeast
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Equus
    • Sequence

      SPAPLPSSMALKELIKELVNITQNQAPLCNGSMVWSVNLTADTYCRALES LSNVSTCSAIQNTRKMLTKLCPHQLSAGQVSSERARDTKIEVIVLVKDLL KNLRKIFHGGKHVDA
    • Predicted molecular weight

      13 kDa
    • Amino acids

      19 to 133
    • Additional sequence information

      This product is for the mature full length protein. The signal peptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab209153 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Additional notes

    ab209153 was produced in yeast and therefore does not have endotoxin, is naturally folded, and post-translationally modified.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C. Avoid freeze / thaw cycle.

    Constituents: 90% PBS, 10% Trehalose

  • Reconstitution
    Reconstitute with sterile phosphate-buffered saline containing at least 0.1% carrier protein. Once reconstituted store at – 20 °C in working aliquots and avoid repeated freeze/thaw cycles.

General Info

  • Alternative names

    • Allergic rhinitis
    • ALRH
    • BHR 1
    • BHR1
    • Bronchial hyperresponsiveness 1 (bronchial asthma)
    • IL 13
    • IL-13
    • Il13
    • IL13_HUMAN
    • Interleukin 13
    • Interleukin-13
    • interleukin13
    • MGC116786
    • MGC116788
    • MGC116789
    • NC 30
    • NC30
    • P 600
    • P600
    see all
  • Function

    Cytokine (PubMed:8096327, PubMed:8097324). Inhibits inflammatory cytokine production (PubMed:8096327). Synergizes with IL2 in regulating interferon-gamma synthesis (PubMed:8096327). May be critical in regulating inflammatory and immune responses (PubMed:8096327, PubMed:8097324). Positively regulates IL31RA expression in macrophages.
  • Involvement in disease

    Allergic rhinitis
  • Sequence similarities

    Belongs to the IL-4/IL-13 family.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab209153 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab209153.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up