Bioactive grade

Recombinant horse IL1 Receptor I/IL-1R-1 protein (Active) (ab243214)

Description

  • Product name

    Recombinant horse IL1 Receptor I/IL-1R-1 protein (Active)
    See all IL1 Receptor I/IL-1R-1 proteins and peptides
  • Biological activity

    Fully biologically active when compared to standard. The ED50 as determined by inhibiting IL-1α- dependent proliferation of murine D10S cells is less than 3.0 μg/ml, corresponding to a specific activity of >333 IU/mg in the presence of 50 pg/ml rHuIL-1α.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Horse
    • Sequence

      HPLGKRPCKMQAFRIWDVNQKTFYMRNNQLVAGYLQESNTKLQEKIDVVP IEPDALFLGLHGRKLCLACVKSGDEIRFQLEAVNITDLSKNKEENKRFTF IRSNSGPTTSFESAACPGWFLCTAQEADRPVSLTNKPKESFMVTKFYLQE DQ
    • Predicted molecular weight

      17 kDa
    • Amino acids

      26 to 177
    • Additional sequence information

      Full-length mature chain lacking the signal peptide.

Specifications

Our Abpromise guarantee covers the use of ab243214 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    HPLC

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituent: PBS

    0.2 µm filtered

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Briefly centrifuge prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at -20 °C or below. Further dilutions should be made in appropriate buffered solutions.

General Info

  • Alternative names

    • Antigen CD121a
    • CD121 antigen-like family member A
    • CD121a
    • CD121a antigen
    • D2S1473
    • IL 1
    • IL 1R 1
    • IL 1R alpha
    • IL 1RT1
    • IL-1R-1
    • IL-1R-alpha
    • IL-1RT-1
    • IL-1RT1
    • IL1 inhibitor
    • IL1 Receptor I
    • IL1R
    • IL1R1
    • IL1R1_HUMAN
    • IL1RA
    • IL1RN
    • IL1RT1
    • Interleukin 1 receptor alpha type 1
    • Interleukin 1 receptor antagonist protein (IRAP)
    • Interleukin 1 receptor type I
    • Interleukin receptor 1
    • Interleukin-1 receptor alpha
    • Interleukin-1 receptor type 1
    • Interleukin-1 receptor type I
    • p80
    see all
  • Function

    Receptor for interleukin-1 alpha (IL-1A), beta (IL-1B), and interleukin-1 receptor antagonist protein (IL-1RA). Binding to the agonist leads to the activation of NF-kappa-B. Signaling involves formation of a ternary complex containing IL1RAP, TOLLIP, MYD88, and IRAK1 or IRAK2.
  • Sequence similarities

    Belongs to the interleukin-1 receptor family.
    Contains 3 Ig-like C2-type (immunoglobulin-like) domains.
    Contains 1 TIR domain.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • SDS Page analysis of ab243214

References

ab243214 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab243214.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up