Overview

Description

  • Nature

    Recombinant
  • Source

    Yeast
  • Amino Acid Sequence
    • Accession
    • Species

      Equus
    • Sequence

      SPYASDTTPCCFAYISRPLPRAHIQEYFYTSSKCSIPAVVFVTRKKRQVC ANPEKKWVREYINTLEMS
    • Molecular weight

      8 kDa
    • Amino acids

      24 to 91
    • Additional sequence information

      mature full length protein: signal peptide is included. Produced in yeast and therefore does not have endotoxin, is naturally folded, and post-translationally modified.

Specifications

Our Abpromise guarantee covers the use of ab208814 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Additional notes

    It can be used in cell culture, as a RANTES ELISA Standard, and as a Western Blot Control.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C. Avoid freeze / thaw cycle. Stable for 12 months at -20°C.

    Constituents: 90% PBS, 10% Trehalose

  • Reconstitution
    Reconstitute with sterile phosphate-buffered saline containing at least 0.1% carrier protein. Stable for at least 3 months when stored in working aliquots with a carrier protein at -20C.

General Info

  • Alternative names

    • Beta chemokine RANTES
    • Beta chemokine RANTES precursor
    • C C motif chemokine 5
    • CCL 5
    • CCL5
    • CCL5_HUMAN
    • Chemokine (C C motif) ligand 5
    • Chemokine CC Motif Ligand 5
    • D17S136E
    • EoCP
    • Eosinophil chemotactic cytokine
    • MGC17164
    • RANTES(4-68)
    • Regulated upon activation normally T expressed and presumably secreted
    • SCYA 5
    • SCYA5
    • SIS delta
    • SIS-delta
    • SISd
    • Small inducible cytokine A5
    • Small inducible cytokine A5 (RANTES)
    • Small inducible cytokine subfamily A (Cys Cys) member 5
    • Small-inducible cytokine A5
    • T cell specific protein p288
    • T cell specific protein RANTES
    • T cell specific RANTES protein
    • T cell-specific protein P228
    • T-cell-specific protein RANTES
    • TCP 228
    • TCP228
    see all
  • Function

    Chemoattractant for blood monocytes, memory T-helper cells and eosinophils. Causes the release of histamine from basophils and activates eosinophils. Binds to CCR1, CCR3, CCR4 and CCR5. One of the major HIV-suppressive factors produced by CD8+ T-cells. Recombinant RANTES protein induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV). The processed form RANTES(3-68) acts as a natural chemotaxis inhibitor and is a more potent inhibitor of HIV-1-infection. The second processed form RANTES(4-68) exhibits reduced chemotactic and HIV-suppressive activity compared with RANTES(1-68) and RANTES(3-68) and is generated by an unidentified enzyme associated with monocytes and neutrophils.
  • Tissue specificity

    T-cell and macrophage specific.
  • Sequence similarities

    Belongs to the intercrine beta (chemokine CC) family.
  • Post-translational
    modifications

    N-terminal processed form RANTES(3-68) is produced by proteolytic cleavage, probably by DPP4, after secretion from peripheral blood leukocytes and cultured sarcoma cells.
    The identity of the O-linked saccharides at Ser-27 and Ser-28 are not reported in PubMed:1380064. They are assigned by similarity.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab208814 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab208814.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up