Recombinant HPV16 E6 (mutated C23 S + C58 S + C87 S + C104 S + C118 S + C147 S) protein (ab188662)

Description

  • Product name

    Recombinant HPV16 E6 (mutated C23 S + C58 S + C87 S + C104 S + C118 S + C147 S) protein
    See all HPV16 E6 proteins and peptides
  • Biological activity

    Typical concentration to support E6AP-mediated p53 ubiquitination in vitro is 0.1-2 μM

  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Sequence

      MHQKRTAMFQDPQERPRKLPQLCTELQTTIHDIILECVYCKQQLLRREVY DFAFRDLCIV YRDGNPYAVCDKCLKFYSKISEYRHYCYSLYGTTLEQQ YNKPLCDLLIRCINCQKPLCPE EKQRHLDKKQRFHNIRGRWTGRCMSC CRSSRTRRETQL
    • Predicted molecular weight

      19 kDa
    • Amino acids

      1 to 158
    • Modifications

      mutated C23 S + C58 S + C87 S + C104 S + C118 S + C147 S
    • Additional sequence information

      Human Papillomavirus type 16 E6

Specifications

Our Abpromise guarantee covers the use of ab188662 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at Room Temperature. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.0
    Constituents: 1.19% HEPES, 2.32% Sodium chloride, 0.03% DTT

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

References

ab188662 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab188662.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up