Description

  • Product name

    Recombinant Human 14-3-3 beta protein (Tagged)
    See all 14-3-3 beta proteins and peptides
  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAY KNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVL ELLDKYLIPNATQPESKVFYLKMKGDYFRYLSEVASGDNKQTTVSNSQQA YQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDE AIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN
    • Predicted molecular weight

      55 kDa including tags
    • Amino acids

      1 to 246
    • Tags

      GST tag N-Terminus
    • Additional sequence information

      NP_647539.

Specifications

Our Abpromise guarantee covers the use of ab219887 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 0.61% Tris, 0.87% Sodium chloride, 5% Trehalose

    Lyophilized from 0.22 µm filtered solution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized protein in sterile deionized water to a final concentration of 1mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • 14 3 3 protein beta/alpha
    • 14-3-3 protein beta/alpha
    • 1433B_HUMAN
    • Brain protein 14 3 3 beta isoform
    • Epididymis secretory protein Li 1
    • GW128
    • HEL S 1
    • HS1
    • KCIP-1
    • KCIP1
    • N-terminally processed
    • Protein 1054
    • Protein kinase C inhibitor protein 1
    • Tyrosine 3 monooxygenase/tryptophan 5 monooxygenase activation protein beta polypeptide
    • YWHAA
    • YWHAB
    see all
  • Function

    Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways. Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner. Negative regulator of osteogenesis.
  • Sequence similarities

    Belongs to the 14-3-3 family.
  • Post-translational
    modifications

    The alpha, brain-specific form differs from the beta form in being phosphorylated.
    Isoform Short contains a N-acetylmethionine at position 1.
  • Cellular localization

    Cytoplasm. Melanosome. Identified by mass spectrometry in melanosome fractions from stage I to stage IV.
  • Information by UniProt

Images

  • SDS-PAGE analysis of reduced ab219887 stained overnight with Coomassie Blue.

    DTT-reduced protein migrates as 53 kDa in SDS-PAGE.

References

ab219887 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab219887.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up