Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MGDREQLLQRARLAEQAERYDDMASAMKAVTELNEPLSNEDRNLLSVAYK NVVGARRSSWRVISSIEQKTMADGNEKKLEKVKAYREKIEKELETVCNDV LSLLDKFLIKNCNDFQYESKVFYLKMKGDYYRYLAEVASGEKKNSVVEAS EAAYKEAFEISKEQMQPTHPIRLGLALNFSVFYYEIQNAPEQACLLAKQA FDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDEEAGEGN
    • Molecular weight

      28 kDa
    • Amino acids

      1 to 246

Associated products

Specifications

Our Abpromise guarantee covers the use of ab210881 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    > 90 % SDS-PAGE.
    ab210881 was purified by using conventional chromatography techniques.
  • Form

    Liquid
  • Additional notes

     This product was previously labelled as 14-3-3 eta

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: 10% Glycerol, 90% PBS

General Info

  • Alternative names

    • 14 3 3 protein eta
    • 14-3-3 eta
    • 14-3-3 protein eta
    • 1433F_HUMAN
    • Brain protein 14-3-3, eta isoform
    • HGNC:12853
    • Protein AS1
    • Tyrosine 3 monooxygenase/tryptophan 5 monooxygenase activation protein 1
    • Tyrosine 3 monooxygenase/tryptophan 5 monooxygenase activation protein eta polypeptide
    • Tyrosine 3 monooxygenase/tryptophan 5 monooxygenase activation protein, eta isoform
    • tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta
    • Tyrosine 3/tryptophan 5 monooxygenase activation protein eta polypeptide
    • YWHA 1
    • YWHA1
    • Ywhah
    see all
  • Function

    Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways. Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner.
  • Tissue specificity

    Expressed mainly in the brain and present in other tissues albeit at lower levels.
  • Sequence similarities

    Belongs to the 14-3-3 family.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3μg ab210881.

References

ab210881 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab210881.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up