Description

  • Product name

    Recombinant Human 15 Lipoxygenase 1 protein
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGLYRIRVSTGASLYAGSNNQVQLWLVGQHGEAALGKRLWPARGKETELK VEVPEYLGPLLFVKLRKRHLLKDDAWFCNWISVQGPGAGDEVRFPCYRWV EGNGVLSLPEGTGRTVGEDPQGLFQKHREEELEERRKLYRWGNWKDGLIL NMAGAKLYDLPVDERFLEDKRVDFEVSLAKGLADLAIKDSLNVLTCWKDL DDFNRIFWCGQSKLAERVRDSWKEDALFGYQFLNGANPVVLRRSAHLPAR LVFPPGMEELQAQLEKELEGGTLFEADFSLLDGIKANVILCSQQHLAAPL VMLKLQPDGKLLPMVIQLQLPRTGSPPPPLFLPTDPPMAWLLAKCWVRSS DFQLHELQSHLLRGHLMAEVIVVATMRCLPSIHPIFKLIIPHLRYTLEIN VRARTGLVSDMGIFDQIMSTGGGGHVQLLKQAGAFLTYSSFCPPDDLADR GLLGVKSSFYPQDALRLWEIIYRYVEGIVSLHYKTDVAVKDDPELQTWCR EITEIGLQGAQDRGFPVSLQARDQVCHFVTMCIFTCTGQHASVHLGQLDW YSWVPNAPCTMRLPPPTTKDATLETVMATLPNFHQASLQMSITWQLGRRQ PVMVAVGQHEEEYFSGPEPKAVLKKFREELAALDKEIEIRNAKLDMPYEY LRPSVVENSVAI
    • Predicted molecular weight

      99 kDa including tags
    • Amino acids

      1 to 662

Specifications

Our Abpromise guarantee covers the use of ab114421 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 15 lipoxygenase 1
    • 15 LIPOXYGENASE RETICULOCYTE ARACHIDONATE
    • 15 LOX
    • 15 LOX 1
    • 15-LOX
    • 15LOX 1
    • ALOX15
    • Arachidonate 15 lipoxygenase
    • Arachidonate 15-lipoxygenase
    • Arachidonate omega 6 lipoxygenase
    • Arachidonate omega-6 lipoxygenase
    • LOG15
    • LOX15_HUMAN
    see all
  • Function

    Converts arachidonic acid to 15S-hydroperoxyeicosatetraenoic acid. Also acts on C-12 of arachidonate as well as on linoleic acid.
  • Pathway

    Lipid metabolism; leukotriene D4 biosynthesis.
  • Sequence similarities

    Belongs to the lipoxygenase family.
    Contains 1 lipoxygenase domain.
    Contains 1 PLAT domain.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • ab114421 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References

ab114421 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Answer

Thank you for contacting us.

We do not offer trial size samples which is why we have 100% Abtrial offer, with this offer your next purchase of similar amount will be free of charge. Unfortunately you have to buy the first vial for testing.

I hope this information is helpful to you. Please do not hesitate to contact us if you need any more advice or information.

Read More

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up