Overview

  • Product name
    Recombinant Human 24p3R protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MASDPIFTLAPPLHCHYGAFPPNASGWEQPPNASGVSVASAALAASAASR VATSTDPSCSGFAPPDFNHCLKDWDYNGLPVLTTNAIGQWDLVCDLGWQV ILEQILFILGFASGYLFLGYPADRFGRRGIVLLTLGLVGPCGVGGAAAGS STGVMALRFLLGFLLAGVDLGVYLMRLELCDPTQRLRVALAGELVGVGGH FLFLGLALVSKDWRFLQRMITAPCILFLFYGWPGLFLESARWLIVKRQIE EAQSVLRILAERNRPHGQMLGEEAQEALQDLENTCPLPATSSFSFASLLN YRNIWKNLLILGFTNFIAHAIRHCYQPVGGGGSPSDFYLCSLLASGTAAL ACVFLGVTVDRFGRRGILLLSMTLTGIASLVLLGLWDCEHPIFPTVWAQQ GNPNRDLNEAAITTFSVLGLFSSQAAAILSTLLAAEVIPTTVRGRGLGLI MALGALGGLSGPAQRLHMGHGAFLQHVVLAACALLCILSIMLLPETKRKL LPEVLRDGELCRRPSLLRQPPPTRCDHVPLLATPNPAL
    • Amino acids
      1 to 538
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153343 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 24p3 receptor
    • 24p3R
    • BOCT
    • BOIT
    • Brain type organic cation transporter
    • Brain-type organic cation transporter
    • hBOIT
    • Lipocalin-2 receptor
    • Neutrophil gelatinase associated lipocalin receptor
    • Neutrophil gelatinase-associated lipocalin receptor
    • NGAL receptor
    • NgalR
    • NGALR2
    • NGALR3
    • OTTHUMP00000082690
    • OTTHUMP00000082691
    • Potent brain type organic ion transporter
    • S22AH_HUMAN
    • Slc22a17
    • Solute carrier family 22 member 17
    • Solute carrier family 22 organic cation transporter member 17
    see all
  • Function
    Cell surface receptor for LCN2 (24p3) that plays a key role in iron homeostasis and transport. Able to bind iron-bound LCN2 (holo-24p3), followed by internalization of holo-24p3 and release of iron, thereby increasing intracellular iron concentration and leading to inhibition of apoptosis. Also binds iron-free LCN2 (apo-24p3), followed by internalization of apo-24p3 and its association with an intracellular siderophore, leading to iron chelation and iron transfer to the extracellular medium, thereby reducing intracellular iron concentration and resulting in apoptosis.
  • Tissue specificity
    Expressed in brain.
  • Sequence similarities
    Belongs to the major facilitator superfamily. Organic cation transporter family.
  • Cellular localization
    Cell membrane. Vacuole membrane. Upon LCN2-binding, it is internalized.
  • Information by UniProt

Images

  • ab153343 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153343 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153343.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up