Overview

  • Product name
    Recombinant Human 27K protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MGRSRSRSPRRERRRSRSTSRERERRRRERSRSRERDRRRSRSRSPHRRR SRSPRRHRSTSPSPSRLKERRDEEKKETKETKSKERQITEEDLEGKTEEE IEMMKLMGFASFDSTKGKKVDGSVNAYAINVSQKRKYRQYMNRKGGFNRP LDFIA
    • Amino acids
      1 to 155
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161245 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 27k
    • Nucleic acid binding protein RY1
    • Nucleic acid-binding protein RY-1
    • Putative nucleic acid binding protein RY 1
    • RY1
    • Small nuclear ribonucleoprotein 27kDa (U4/U6.U5)
    • SNR27_HUMAN
    • snrnp27
    • U4/U6.U5 27K
    • U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein
    • U4/U6.U5 snRNP 27 kDa protein
    • U4/U6.U5 tri snRNP associated 27 kDa protein
    • U4/U6.U5 tri snRNP associated protein 3
    • U4/U6.U5 tri-snRNP-associated 27 kDa protein
    • U4/U6.U5 tri-snRNP-associated protein 3
    • U4/U6.U5-27K
    see all
  • Function
    May play a role in mRNA splicing.
  • Sequence similarities
    Belongs to the SNUT3 family.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR. Phosphorylated in vitro by snRNP-associated protein kinase.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab161245 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161245 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161245.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up