Recombinant human 2B4 protein - BSA and Azide free (ab185248)
Key features and details
- Expression system: HEK 293 cells
- Purity: > 95% SDS-PAGE
- Endotoxin level: < 1.000 Eu/µg
- Active: Yes
- Tags: His tag C-Terminus
- Suitable for: Functional Studies, SDS-PAGE
Description
-
Product name
Recombinant human 2B4 protein - BSA and Azide free
See all 2B4 proteins and peptides -
Biological activity
Immobilized Recombinant human 2B4 protein (ab185248) at 5 μg/mL (100 μL/well) can bind Human CD48, Fc Tag with a linear range of 0.078-1.25 μg/mL.
-
Purity
> 95 % SDS-PAGE. -
Endotoxin level
< 1.000 Eu/µg -
Expression system
HEK 293 cells -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Carrier free
Yes -
Nature
Recombinant -
-
Species
Human -
Sequence
CQGSADHVVSISGVPLQLQPNSIQTKVDSIAWKKLLPSQNGFHHILKWEN GSLPSNTSNDRFSFIVKNLSLLIKAAQQQDSGLYCLEVTSISGKVQTATF QVFVFDKVEKPRLQGQGKILDRGRCQVALSCLVSRDGNVSYAWYRGSKLI QTAGNLTYLDEEVDINGTHTYTCNVSNPVSWESHTLNLTQDCQNAHQEFR -
Predicted molecular weight
23 kDa including tags -
Amino acids
22 to 221 -
Tags
His tag C-Terminus -
Additional sequence information
NCBI accession No. NP_057466
-
-
Description
Recombinant human 2B4 protein (BSA and azide free)
Specifications
Our Abpromise guarantee covers the use of ab185248 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Functional Studies
SDS-PAGE
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at 4°C prior to reconstitution. Upon reconsitution add a carrier protein (0.1% BSA). Store at -20°C or -80°C. Avoid freeze / thaw cycle.
pH: 7.40
Constituents: 5% Trehalose, 95% PBS
Lyophilized from 0.22 µm filtered solution.This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionReconstitute with sterile deionized water to a concentration of 200 µg/ml.
General Info
-
Alternative names
- 2B4
- C9.1
- CD244
see all -
Function
Modulate other receptor-ligand interactions to enhance leukocyte activation. -
Tissue specificity
Expressed in spleen, PBL, followed by lung, liver, testis and small intestine. Expressed not only in NK cells, but also on monocytes and basophils. -
Sequence similarities
Contains 2 Ig-like (immunoglobulin-like) domains. -
Cellular localization
Membrane. - Information by UniProt
Images
-
SDS-PAGE analysis of ab185248 in reducing conditions. Gel stained overnight with Coomassie Blue. DTT-reduced protein migrates as 40-50 kDa due to glycosylation.
-
Immobilized Recombinant human 2B4 protein (ab185248) at 5 μg/mL (100 μL/well) can bind Human CD48, Fc Tag with a linear range of 0.078-1.25 μg/mL.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab185248 has not yet been referenced specifically in any publications.