Overview

Description

  • Nature

    Recombinant
  • Source

    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      CQGSADHVVSISGVPLQLQPNSIQTKVDSIAWKKLLPSQNGFHHILKWEN GSLPSNTSNDRFSFIVKNLSLLIKAAQQQDSGLYCLEVTSISGKVQTATF QVFVFDKVEKPRLQGQGKILDRGRCQVALSCLVSRDGNVSYAWYRGSKLI QTAGNLTYLDEEVDINGTHTYTCNVSNPVSWESHTLNLTQDCQNAHQEFR
    • Molecular weight

      23 kDa including tags
    • Amino acids

      22 to 221
    • Tags

      His tag C-Terminus
    • Additional sequence information

      NCBI accession No. NP_057466

Specifications

Our Abpromise guarantee covers the use of ab185248 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Immobilized Recombinant human 2B4 protein (ab185248) at 5 μg/mL (100 μL/well) can bind Human CD48, Fc Tag with a linear range of 0.078-1.25 μg/mL.

  • Applications

    Functional Studies

    SDS-PAGE

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 95 % SDS-PAGE.

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at 4°C prior to reconstitution. Upon reconsitution add a carrier protein (0.1% BSA). Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 5% Trehalose, 95% PBS

    Lyophilized from 0.22 µm filtered solution.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized protein in sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing.

General Info

  • Alternative names

    • 2B4
    • C9.1
    • CD244
    • CD244 antigen
    • CD244 molecule
    • CD244 molecule natural killer cell receptor 2B4
    • CD244 natural killer cell receptor 2B4
    • CD244_HUMAN
    • F730046O15Rik
    • h2B4
    • Ly90
    • NAIL
    • Natural killer cell activation-inducing ligand
    • Natural killer cell receptor 2B4
    • NK cell activation inducing ligand
    • NK cell activation inducing ligand NAIL
    • NK cell activation-inducing ligand
    • NK cell type I receptor protein 2B4
    • NKR2B4
    • Nmrk
    • Non-MHC restricted killing associated
    • OTTHUMP00000027884
    • p38
    • signaling lymphocytic activation molecule 4
    • SLAM family, member 4
    • SLAMF4
    see all
  • Function

    Modulate other receptor-ligand interactions to enhance leukocyte activation.
  • Tissue specificity

    Expressed in spleen, PBL, followed by lung, liver, testis and small intestine. Expressed not only in NK cells, but also on monocytes and basophils.
  • Sequence similarities

    Contains 2 Ig-like (immunoglobulin-like) domains.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab185248 in reducing conditions. Gel stained overnight with Coomassie Blue. DTT-reduced protein migrates as 40-50 kDa due to glycosylation.

  • Immobilized Recombinant human 2B4 protein (ab185248) at 5 μg/mL (100 μL/well) can bind Human CD48, Fc Tag with a linear range of 0.078-1.25 μg/mL.

References

ab185248 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab185248.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up