Description

  • Product name

    Recombinant Human 2B4 protein (Tagged) (Biotin)
    See all 2B4 proteins and peptides
  • Purity

    > 90 % SDS-PAGE.
    The biotin to protein ratio is 0.3-1 as determined by the HABA assay.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      CQGSADHVVSISGVPLQLQPNSIQTKVDSIAWKKLLPSQNGFHHILKWEN GSLPSNTSNDRFSFIVKNLSLLIKAAQQQDSGLYCLEVTSISGKVQTATF QVFVFDKVEKPRLQGQGKILDRGRCQVALSCLVSRDGNVSYAWYRGSKLI QTAGNLTYLDEEVDINGTHTYTCNVSNPVSWESHTLNLTQDCQNAHQEFR
    • Predicted molecular weight

      25 kDa including tags
    • Amino acids

      22 to 221
    • Tags

      His tag C-Terminus , Avi tag C-Terminus
    • Additional sequence information

      Biotinylation of this product is performed using Avitag™ technology. Briefly, the single lysine residue in the Avitag is enzymatically labeled with biotin. AviTag sequence GLNDIFEAQKIEWHE.
  • Conjugation

    Biotin

Specifications

Our Abpromise guarantee covers the use of ab246096 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Additional notes

    Recommended for biopanning.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon reconsitution add a carrier protein (0.1% BSA). Store at -20°C or -80°C. Avoid freeze / thaw cycle. Store In the Dark.

    pH: 7.40
    Constituents: PBS, 5% Trehalose

    0.22 µm filtered

  • Reconstitution
    It is recommended to reconstitute the lyophilized product in sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • 2B4
    • C9.1
    • CD244
    • CD244 antigen
    • CD244 molecule
    • CD244 molecule natural killer cell receptor 2B4
    • CD244 natural killer cell receptor 2B4
    • CD244_HUMAN
    • F730046O15Rik
    • h2B4
    • Ly90
    • NAIL
    • Natural killer cell activation-inducing ligand
    • Natural killer cell receptor 2B4
    • NK cell activation inducing ligand
    • NK cell activation inducing ligand NAIL
    • NK cell activation-inducing ligand
    • NK cell type I receptor protein 2B4
    • NKR2B4
    • Nmrk
    • Non-MHC restricted killing associated
    • OTTHUMP00000027884
    • p38
    • signaling lymphocytic activation molecule 4
    • SLAM family, member 4
    • SLAMF4
    see all
  • Function

    Modulate other receptor-ligand interactions to enhance leukocyte activation.
  • Tissue specificity

    Expressed in spleen, PBL, followed by lung, liver, testis and small intestine. Expressed not only in NK cells, but also on monocytes and basophils.
  • Sequence similarities

    Contains 2 Ig-like (immunoglobulin-like) domains.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • SDS-PAGE - Recombinant Human 2B4 protein (Tagged) (Biotin) (ab246096).

    The protein migrates as 40-65 kDa under reducing conditions due to glycosylation.

References

ab246096 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab246096.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up