Overview

  • Product name

    Recombinant Human 2DD protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MALRWGIVSVGLISSDFTAVLQTLPRSEHQVVAVAARDLSRAKEFAQKHD IPKAYGSYEELAKDPSVEVAYIGTQHPQHKAAVMLCLAAGKAVLCEKPTG VNAAEVREMVAEARSRALFLMEAIWTRFFPASEALRSVLAQGTLGDLRVA RAEFGKNLIHVPRAVDRAQAGGALLDIGIYCVQFTSMVFGGQKPEKISVV GRRHETGVDDTVTVLLQYPGEVHGSFTCSITVQLSNTASVSGTKGMVQLL NPCWCPTELVVKGEHKEFPLPPVPKDCNFDNGAGMSYEAKHVWECLRKGM KESPVIPLSESELLADILEEVRKAIGVTFPQDKR
    • Amino acids

      1 to 334
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162137 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 2-dihydrobenzene-1
    • 2-diol dehydrogenase
    • 2DD
    • 3 deoxyglucosone reductase
    • D xylose 1 dehydrogenase
    • D xylose NADP dehydrogenase
    • D-xylose 1-dehydrogenase
    • D-xylose-NADP dehydrogenase
    • DHDH
    • DHDH_HUMAN
    • dihydrodiol dehydrogenase (dimeric)
    • Dimeric dihydrodiol dehydrogenase
    • HUM2DD
    • Trans-1
    see all
  • Tissue specificity

    Small intestine.
  • Sequence similarities

    Belongs to the Gfo/Idh/MocA family.
  • Information by UniProt

Images

  • ab162137 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162137 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162137.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up