Overview

  • Product name
    Recombinant Human 3-OST-4 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      ERLIVDPAGEMAKVQDFLGLKRVVTKKHFYFNKTKGFPCLKKPEDSSAPR CLGKSKGRTHPRIDPDVIHRLRKFYKPFNLMFYQMTGQDFQWEQEEGD
    • Amino acids
      358 to 455
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160735 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 3-OST-4
    • 30ST4
    • 3OST4
    • h3-OST-4
    • Heparan sulfate (glucosamine) 3-O-sulfotransferase 4
    • Heparan sulfate 3-O-sulfotransferase 4
    • Heparan sulfate D-glucosaminyl 3-O-sulfotransferase 4
    • Heparan sulfate glucosamine 3-O-sulfotransferase 4
    • HS3S4_HUMAN
    • HS3ST4
    see all
  • Function
    Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) to catalyze the transfer of a sulfo group to an N-unsubstituted glucosamine linked to a 2-O-sulfo iduronic acid unit on heparan sulfate. Unlike 3-OST-1, does not convert non-anticoagulant heparan sulfate to anticoagulant heparan sulfate.
  • Tissue specificity
    Brain-specific.
  • Sequence similarities
    Belongs to the sulfotransferase 1 family.
  • Cellular localization
    Golgi apparatus membrane.
  • Information by UniProt

Images

  • ab160735 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160735 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160735.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up