For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

Hello. We're improving abcam.com and we'd welcome your feedback.

Hello. We're improving abcam.com and we'd welcome your feedback.

Infomation icon

We haven't added this to the BETA yet

New BETA website

New BETA website

Hello. We're improving abcam.com and we'd welcome your feedback.

Take a look at our BETA site and see what we’ve done so far.

Switch on our new BETA site

Now available

Search and browse selected products

  • A selection of primary antibodies

Purchase these through your usual distributor

In the coming months

  • Additional product types
  • Supporting content
  • Sign in to your account
  • Purchase online
United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Customized Products & Partnerships
    Customized Products & Partnerships

    Customized products and commercial partnerships to accelerate your diagnostic and therapeutic programs.

    Customized products

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Explore the power of knock-out cell lines for your research

  1. Link

    recombinant-human-4-1bbl-protein-ab168048.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Immunology Adaptive Immunity T Cells Cytotoxic Cells
Share by email
Bioactive grade

Recombinant human 4-1BBL protein (ab168048)

  • Datasheet
Submit a review Submit a question

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Shipping info

Promotion Information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Functional Studies - Recombinant human 4-1BBL protein (ab168048)

    Key features and details

    • Expression system: HEK 293 cells
    • Purity: > 95% SDS-PAGE
    • Endotoxin level: < 0.100 Eu/µg
    • Active: Yes
    • Tags: DDDDK tag N-Terminus
    • Suitable for: Functional Studies, SDS-PAGE

    You may also be interested in

    ELISA
    Product image
    Human 4-1BBL ELISA Kit (ab246536)
    Pair
    Product image
    Human 4-1BBL Antibody Pair - BSA and Azide free (ab256681)
    Protein
    Product image
    Recombinant Human TNFL9 Protein (Active) (ab283931)

    View more associated products

    Description

    • Product name

      Recombinant human 4-1BBL protein
      See all 4-1BBL proteins and peptides
    • Biological activity

      ab168048 binds to Human CD137 (4-1BB).
    • Purity

      > 95 % SDS-PAGE.

    • Endotoxin level

      < 0.100 Eu/µg
    • Expression system

      HEK 293 cells
    • Accession

      P41273
    • Protein length

      Protein fragment
    • Animal free

      No
    • Nature

      Recombinant
      • Species

        Human
      • Sequence

        LACPWAVSGARASPGSAASPRLREGPELSPDDPAGLLDLRQGMFAQLVAQ NVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLE LRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFG FQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGL PSPRSE
      • Predicted molecular weight

        27 kDa including tags
      • Amino acids

        49 to 254
      • Tags

        DDDDK tag N-Terminus

    Associated products

    • Related Products

      • Anti-DDDDK tag (Binds to FLAG® tag sequence) antibody (ab1162)
      • Anti-DDDDK tag (Binds to FLAG® tag sequence) antibody [F-tag-01] (ab18230)
      • Anti-DDDDK tag (Binds to FLAG® tag sequence) antibody (ab21536)

    Specifications

    Our Abpromise guarantee covers the use of ab168048 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    • Applications

      Functional Studies

      SDS-PAGE

    • Form

      Lyophilized
    • Additional notes

      ab168048 binds to Human CD137 (4-1BB).
    • Concentration information loading...

    Preparation and Storage

    • Stability and Storage

      Shipped at 4°C. Store at -20ºC.

      Constituents: 94% PBS, 5% Trehalose

      This product is an active protein and may elicit a biological response in vivo, handle with caution.

    • Reconstitution
      Reconstitute with 100µl sterile distilled water for a final concentration of 0.1mg/ml. After reconstitution, prepare aliquots and store at -20°C. Avoid freeze/thaw cycles. Further dilutions should be made with medium containing 5% fetal calf serum.

    General Info

    • Alternative names

      • 4 1BB L
      • 4 1BB ligand
      • 4 1BBL
      • 4-1BB ligand
      • 4-1BBL
      • Cd137l
      • Cd157l
      • Homolog of mouse 4 1BB L
      • Homolog of mouse 4 1BBL
      • ILA ligand (TNF related)
      • Ly63l
      • Receptor 4 1BB ligand
      • TNF superfamily member 9
      • TNFL9_HUMAN
      • Tnfsf9
      • TNLG5A
      • Tumor necrosis factor (ligand) superfamily member 9
      • Tumor necrosis factor ligand 5A
      • Tumor necrosis factor ligand superfamily member 9
      • Tumor necrosis factor superfamily member 9
      see all
    • Function

      Cytokine that binds to TNFRSF9. Induces the proliferation of activated peripheral blood T-cells. May have a role in activation-induced cell death (AICD). May play a role in cognate interactions between T-cells and B-cells/macrophages.
    • Tissue specificity

      Expressed in brain, placenta, lung, skeletal muscle and kidney.
    • Sequence similarities

      Belongs to the tumor necrosis factor family.
    • Cellular localization

      Membrane.
    • Target information above from: UniProt accession P41273 The UniProt Consortium
      The Universal Protein Resource (UniProt) in 2010
      Nucleic Acids Res. 38:D142-D148 (2010) .

      Information by UniProt

    Images

    • Functional Studies - Recombinant human 4-1BBL protein (ab168048)
      Functional Studies - Recombinant human 4-1BBL protein (ab168048)

      Dose-dependent binding of ab168048. Recombinant Human 4-1BBL saturates its receptor at a concentration range of 2-4000ng/ml. Method: Receptor binding assay: a 96-well ELISA plate was coated O/N with 50ng per well of CD137 (Human):Fc (Human) (rec.) (4-1BB:Fc). After a blocking step, the indicated concentrations of ab168048 were added for 1 hour. After extensive washing, an Enhancer was added for 1 hour. Bound ligand was revealed by a rabbit anti-mouse IgG-HRP (1/1000 dilution) incubated for 1 hour. OPD was used as a substrate and absorbance was measured at 490nm in an ELISA reader.

    Protocols

    To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

    Click here to view the general protocols

    Datasheets and documents

    • Datasheet download

      Download

    References (0)

    Publishing research using ab168048? Please let us know so that we can cite the reference in this datasheet.

    ab168048 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab168048.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2022 Abcam plc. All rights reserved.