Recombinant human 4-1BBL protein (ab168048)
Key features and details
- Expression system: HEK 293 cells
- Purity: > 95% SDS-PAGE
- Endotoxin level: < 0.100 Eu/µg
- Active: Yes
- Tags: DDDDK tag N-Terminus
- Suitable for: Functional Studies, SDS-PAGE
Description
-
Product name
Recombinant human 4-1BBL protein
See all 4-1BBL proteins and peptides -
Biological activity
ab168048 binds to Human CD137 (4-1BB). -
Purity
> 95 % SDS-PAGE. -
Endotoxin level
< 0.100 Eu/µg -
Expression system
HEK 293 cells -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
LACPWAVSGARASPGSAASPRLREGPELSPDDPAGLLDLRQGMFAQLVAQ NVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLE LRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFG FQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGL PSPRSE -
Predicted molecular weight
27 kDa including tags -
Amino acids
49 to 254 -
Tags
DDDDK tag N-Terminus
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab168048 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Functional Studies
SDS-PAGE
-
Form
Lyophilized -
Additional notes
ab168048 binds to Human CD137 (4-1BB). -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at -20ºC.
Constituents: 94% PBS, 5% Trehalose
This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionReconstitute with 100µl sterile distilled water for a final concentration of 0.1mg/ml. After reconstitution, prepare aliquots and store at -20°C. Avoid freeze/thaw cycles. Further dilutions should be made with medium containing 5% fetal calf serum.
General Info
-
Alternative names
- 4 1BB L
- 4 1BB ligand
- 4 1BBL
see all -
Function
Cytokine that binds to TNFRSF9. Induces the proliferation of activated peripheral blood T-cells. May have a role in activation-induced cell death (AICD). May play a role in cognate interactions between T-cells and B-cells/macrophages. -
Tissue specificity
Expressed in brain, placenta, lung, skeletal muscle and kidney. -
Sequence similarities
Belongs to the tumor necrosis factor family. -
Cellular localization
Membrane. - Information by UniProt
Images
-
Dose-dependent binding of ab168048. Recombinant Human 4-1BBL saturates its receptor at a concentration range of 2-4000ng/ml. Method: Receptor binding assay: a 96-well ELISA plate was coated O/N with 50ng per well of CD137 (Human):Fc (Human) (rec.) (4-1BB:Fc). After a blocking step, the indicated concentrations of ab168048 were added for 1 hour. After extensive washing, an Enhancer was added for 1 hour. Bound ligand was revealed by a rabbit anti-mouse IgG-HRP (1/1000 dilution) incubated for 1 hour. OPD was used as a substrate and absorbance was measured at 490nm in an ELISA reader.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab168048 has not yet been referenced specifically in any publications.