Description

  • Product name

    Recombinant Human 5 Lipoxygenase/5-LO protein
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MPSYTVTVATGSQWFAGTDDYIYLSLVGSAGCSEKHLLDKPFYNDFERGA VDSYDVTVDEELGEIQLVRIEKRKYWLNDDWYLKYITLKTPHGDYIEFPC YRWITGDVEVVLRDGRAKLARDDQIHILKQHRRKELETRQKQYRWMEWNP GFPLSIDAKCHKDLPRDIQFDSEKGVDFVLNYSKAMENLFINRFMHMFQS SWNDFADFEKIFVKISNTISERVMNHWQEDLMFGYQFLNGCNPVLIRRCT ELPEKLPVTTEMVECSLERQLSLEQEVQQGNIFIVDFELLDGIDANKTDP CTLQFLAAPICLLYKNLANKIVPIAIQLNQIPGDENPIFLPSDAKYDWLL AKIWVRSSDFHVHQTITHLLRTHLVSEVFGIAMYRQLPAVHPIFKLLVAH VRFTIAINTKAREQLICECGLFDKANATGGGGHVQMVQRAMKDLTYASLC FPEAIKARGMESKEDIPYYFYRDDGLLVWEAIRTFTAEVVDIYYEGDQVV EEDPELQDFVNDVYVYGMRGRKSSGFPKSVKSREQLSEYLTVVIFTASAQ HAAVNFGQYDWCSWIPNAPPTMRAPPPTAKGVVTIEQIVDTLPDRGRSCW HLGAVWALSQFQENELFLGMYPEEHFIEKPVKEAMARFRKNLEAIVSVIA ERNKKKQLPYYYLSPDRIPNSVAI
    • Predicted molecular weight

      100 kDa including tags
    • Amino acids

      1 to 674

Specifications

Our Abpromise guarantee covers the use of ab114310 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names

    • 5 Lipoxygenase
    • 5 LO
    • 5 LOX
    • 5-lipoxygenase
    • 5-LO
    • 5-LOX
    • 5LOX
    • 5LPG
    • ALOX 5
    • Alox5
    • Arachidonate 5 lipoxygenase
    • Arachidonate 5-lipoxygenase
    • arachidonic 5-lipoxygenase alpha-10 isoform
    • arachidonic 5-lipoxygenase delta-10-13 isoform
    • arachidonic 5-lipoxygenase delta-13 isoform
    • arachidonic 5-lipoxygenase delta-p10 isoform
    • Arachidonic acid 5 lipoxygenase
    • Leukotriene A4 synthase
    • LOG 5
    • LOG5
    • LOX5_HUMAN
    • MGC163204
    see all
  • Function

    Catalyzes the first step in leukotriene biosynthesis, and thereby plays a role in inflammatory processes.
  • Pathway

    Lipid metabolism; leukotriene A4 biosynthesis.
  • Sequence similarities

    Belongs to the lipoxygenase family.
    Contains 1 lipoxygenase domain.
    Contains 1 PLAT domain.
  • Post-translational
    modifications

    Serine phosphorylation by MAPKAPK2 is stimulated by arachidonic acid. Phosphorylation on Ser-523 by PKA has an inhibitory effect. Phosphorylation on Ser-272 prevents export from the nucleus.
  • Cellular localization

    Cytoplasm. Nucleus matrix. Nucleus membrane. Shuttles between cytoplasm and nucleus. Found exclusively in the nucleus, when phosphorylated on Ser-272. Calcium binding promotes translocation from the cytosol and the nuclear matrix to the nuclear envelope and membrane association.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab114310 on a 12.5% gel stained with Coomassie Blue.

References

ab114310 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up