Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MLCHRGGQLIVPIIPLCPEHSCRGRRLQNLLSGPWPKQPMELHNLSSPSP SLSSSVLPPSFSPSPSSAPSAFTTVGGSSGGPCHPTSSSLVSAFLAPILA LEFVLGLVGNSLALFIFCIHTRPWTSNTVFLVSLVAADFLLISNLPLRVD YYLLHETWRFGAAACKVNLFMLSTNRTASVVFLTAIALNRYLKVVQPHHV LSRASVGAAARVAGGLWVGILLLNGHLLLSTFSGPSCLSYRVGTKPSASL RWHQALYLLEFFLPLALILFAIVSIGLTIRNRGLGGQAGPQRAMRVLAMV VAVYTICFLPSIIFGMASMVAFWLSACRSLDLCTQLFHGSLAFTYLNSVL DPVLYCFSSPNFLHQSRALLGLTRGRQGPVSDESSYQPSRQWRYREASRK AEAIGKLKVQGEVSLEKEGSSQG
    • Amino acids
      1 to 423
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165776 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 5 oxo ETE acid G protein coupled receptor 1
    • 5 oxo ETE G protein coupled receptor
    • 5-oxo-ETE G-protein coupled receptor
    • G protein coupled receptor 170
    • G protein coupled receptor R527
    • G protein coupled receptor TG1019
    • G-protein coupled receptor 170
    • G-protein coupled receptor R527
    • G-protein coupled receptor TG1019
    • GPCR
    • GPR170
    • OTTHUMP00000158809
    • OXER1
    • OXER1_HUMAN
    • Oxoeicosanoid (OXE) receptor 1
    • Oxoeicosanoid receptor 1
    • TG1019
    see all
  • Function
    Receptor for eicosanoids and polyunsaturated fatty acids such as 5-oxo-6E,8Z,11Z,14Z-eicosatetraenoic acid (5-OXO-ETE), 5(S)-hydroperoxy-6E,8Z,11Z,14Z-eicosatetraenoic acid (5(S)-HPETE) and arachidonic acid. Seems to be coupled to the G(i)/G(o), families of heteromeric G proteins.
  • Tissue specificity
    Expressed in various tissues except brain. Expression is more intense in liver, kidney, peripheral leukocyte, lung, and spleen than in other tissues. Highly expressed in eosinophils, neutrophils, and lung macrophages.
  • Sequence similarities
    Belongs to the G-protein coupled receptor 1 family.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • ab165776 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165776 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165776.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up