Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MDVLSPGQGNNTTSPPAPFETGGNTTGISDVTVSYQVITSLLLGTLIFCA VLGNACVVAAIALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLN KWTLGQVTCDLFIALDVLCCTSSILHLCAIALDRYWAITDPIDYVNKRTP RRAAALISLTWLIGFLISIPPMLGWRTPEDRSDPDACTISKDHGYTIYST FGAFYIPLLLMLVLYGRIFRAARFRIRKTVKKVEKTGADTRHGASPAPQP KKSVNGESGSRNWRLGVESKAGGALCANGAVRQGDDGAALEVIEVHRVGN SKEHLPLPSEAGPTPCAPASFERKNERNAEAKRKMALARERKTVKTLGII MGTFILCWLPFFIVALVLPFCESSCHMPTLLGAIINWLGYSNSLLNPVIY AYFNKDFQNAFKKIIKCKFCRQ
    • Molecular weight

      73 kDa including tags
    • Amino acids

      1 to 422
    • Tags

      GST tag N-Terminus

Associated products

Specifications

Our Abpromise guarantee covers the use of ab132419 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 5 HT 1A
    • 5 HT receptor 1A
    • 5 HT1A
    • 5 HT1A receptor
    • 5 hydroxytryptamine (serotonin) receptor 1A
    • 5 hydroxytryptamine (serotonin) receptor 1A G protein coupled
    • 5 hydroxytryptamine receptor 1A
    • 5-HT-1A
    • 5-HT1A
    • 5-hydroxytryptamine receptor 1A
    • 5HT 1A
    • 5HT 1A receptor
    • 5HT receptor 1A
    • 5HT1a
    • 5HT1A_HUMAN
    • ADRB2RL1
    • ADRBRL1
    • G 21
    • G protein coupled receptor
    • G-21
    • Gpcr 18
    • Gpcr18
    • Guanine nucleotide binding regulatory protein-coupled receptor
    • Htr1a
    • PFMCD
    • Serotonin 1A receptor
    • Serotonin 5HT1A receptor
    • Serotonin receptor 1A
    see all
  • Function

    This is one of the several different receptors for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. The activity of this receptor is mediated by G proteins that inhibit adenylate cyclase activity.
  • Sequence similarities

    Belongs to the G-protein coupled receptor 1 family. 5-hydroxytryptamine receptor subfamily. HTR1A sub-subfamily.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132419, stained with Coomassie Blue.

References

ab132419 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132419.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up