Description

  • Product name

    Recombinant Human 5HT1B Receptor protein
  • Expression system

    Wheat germ
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MEEPGAQCAPPPPAGSETWVPQANLSSAPSQNCSAKDYIYQDSISLPWK
    • Amino acids

      1 to 49
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158711 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 5 HT1DB
    • 5 hydroxytryptamine receptor 1B
    • 5-HT-1B
    • 5-HT-1D-beta
    • 5-HT1B
    • 5-hydroxytryptamine receptor 1B
    • 5HT1B_HUMAN
    • Htr1b
    • HTR1D2
    • HTR1DB
    • S12
    • Serotonin 1D beta receptor
    • Serotonin receptor 1B
    see all
  • Function

    This is one of the several different receptors for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. The activity of this receptor is mediated by G proteins that inhibit adenylate cyclase activity.
  • Sequence similarities

    Belongs to the G-protein coupled receptor 1 family.
  • Post-translational
    modifications

    Phosphorylated. Desensitization of the receptor may be mediated by its phosphorylation.
    Palmitoylated.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

Images

  • ab158711 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158711 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158711.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up