Overview

  • Product name

    Recombinant Human 5HT1F Receptor protein (Tagged)
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Cell free
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MDFLNSSDQNLTSEELLNRMPSKILVSLTLSGLALMTTTINSLVIAAIIV TRKLHHPANYLICSLAVTDFLVAVLVMPFSIVYIVRESWIMGQVVCDIWL SVDITCCTCSILHLSAIALDRYRAITDAVEYARKRTPKHAGIMITIVWII SVFISMPPLFWRHQGTSRDDECIIKHDHIVSTIYSTFGAFYIPLALILIL YYKIYRAAKTLYHKRQASRIAKEEVNGQVLLESGEKSTKSVSTSYVLEKS LSDPSTDFDKIHSTVRSLRSEFKHEKSWRRQKISGTRERKAATTLGLILG AFVICWLPFFVKELVVNVCDKCKISEEMSNFLAWLGYLNSLINPLIYTIF NEDFKKAFQKLVRCRC
    • Molecular weight

      60 kDa including tags
    • Amino acids

      1 to 366
    • Tags

      His tag N-Terminus
    • Additional sequence information

      N-terminal 10xHis-SUMO-tagged. In vitro E. coli expression system.

Specifications

Our Abpromise guarantee covers the use of ab235616 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    > 85 % SDS-PAGE.
    Purified from an in vitro E.coli expression system.
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names

    • 5 HT 1F
    • 5 HT1F
    • 5 hydroxytryptamine (serotonin) receptor 1F
    • 5 hydroxytryptamine 1F receptor
    • 5 hydroxytryptamine receptor 1E beta
    • 5 hydroxytryptamine receptor 1F
    • 5 hydroxytryptamine serotonin receptor 1E beta
    • 5 hydroxytryptamine serotonin receptor 1F
    • 5HT 1F
    • 5HT1F
    • HGNC5292
    • HTR 1F
    • HTR1EB
    • HTR1EL
    • HTR1F
    • MR 77
    • MR77
    • Serotonin receptor 1E beta
    • Serotonin receptor gene
    see all
  • Relevance

    5HT1F is one of the several different receptors for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. The activity of this receptor is mediated by G proteins that inhibit adenylate cyclase activity. 5HT1F is a member of the GPCR family (subfamily: Serotonin). Expression of 5HT1F has been reported in various brain structures, including cortex, hippocampus, trigeminal ganglia, and cerebral blood vessels. Expression in peripheral tissues is limited to uterus, mesentery, and artery. No expression has been detected in heart, kidney, liver, pancreas, or spleen.
  • Cellular localization

    Cell membrane; Multi pass membrane protein.

Images

  • ab235616 analyzed by (Tris-Glycine gel) discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

References

ab235616 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235616.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up