Description

  • Product name

    Recombinant Human 5HT4 Receptor protein
    See all 5HT4 Receptor proteins and peptides
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MDKLDANVSSEEGFGSVEKVVLLTFLSTVILMAILGNLLVMVAVCWDRQL RKIKTNYFIVSLAFADLLVSVLVMPFGAIELVQDIWIYGEVFCLVRTSLD VLLTTASIFHLCCISLDRYYAICCQPLVYRNKMTPLRIALMLGGCWVIPT FISFLPIMQGWNNIGIIDLIEKRKFNQNSNSTYCVFMVNKPYAITCSVVA FYIPFLLMVLAYYRIYVTAKEHAHQIQMLQRAGASSESRPQSADQHSTHR MRTETKAAKTLCIIMGCFCLCWAPFFVTNIVDPFIDYTVPGQVWTAFLWL GYINSGLNPFLYAFLNKSFRRAFLIILCCDDERYRRPSILGQTVPCSTTT INGSTHVLRDAVECGGQWESQCHPPATSPLVAAQPSDT
    • Amino acids

      1 to 388
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158717 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 5 HT 4
    • 5 HT4
    • 5 HT4R
    • 5 hydroxytryptamine (serotonin) receptor 4, G protein coupled
    • 5 hydroxytryptamine 4 receptor
    • 5 hydroxytryptamine receptor 4
    • 5 hydroxytryptamine serotonin receptor 4
    • 5 hydroxytryptamine4 receptor
    • 5-HT-4
    • 5-ht4
    • 5-HT4R
    • 5H4
    • 5HT 4
    • 5HT4
    • 5ht4 receptor
    • 5HT4R
    • Cardiac 5 HT4 receptor
    • HTR 4
    • HTR4
    • serotonin 4 receptor
    • Serotonin 5 HT4 receptor
    • serotonin 5-ht-4 receptor
    • serotonin 5-ht-4a
    • Serotonin receptor 4
    see all
  • Relevance

    The 5HT4 Receptor is one of the several different receptors for 5- hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. The activity of this receptor is mediated by G proteins that stimulates adenylate cyclase. 5HT4a receptors may play a role in opioid-induced respiratory depression.
  • Cellular localization

    Cell membrane; Multi-pass membrane protein. Endosome. Note: Interaction with SNX27 mediates recruitment to early endosomes, while interaction with SLC9A3R1 and EZR might target the protein to specialized subcellular regions, such as microvilli.

Images

  • ab158717 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158717 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158717.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up