Overview

Description

  • Nature

    Recombinant
  • Source

    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      SSPTSSASSFSSSAPFLASAVSAQPPLPDQCPALCECSEAARTVKCVNRN LTEVPTDLPAYVRNLFLTGNQLAVLPAGAFARRPPLAELAALNLSGSRLD EVRAGAFEHLPSLRQLDLSHNPLADLSPFAFSGSNASVSAPSPLVELILN HIVPPEDERQNRSFEGMVVAALLAGRALQGLRRLELASNHFLYLPRDVLA QLPSLRHLDLSNNSLVSLTYVSFRNLTHLESLHLEDNALKVLHNGTLAEL QGLPHIRVFLDNNPWVCDCHMADMVTWLKETEVVQGKDRLTCAYPEKMRN RVLLELNSADLDCDPILPPSLQTS
    • Molecular weight

      39 kDa including tags
    • Amino acids

      32 to 355
    • Tags

      His tag C-Terminus , Avi tag C-Terminus
    • Additional sequence information

      Extracellular domain. AviTag sequence GLNDIFEAQKIEWHE.
  • Conjugation

    Biotin

Specifications

Our Abpromise guarantee covers the use of ab246200 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 90 % SDS-PAGE.
    The biotin to protein ratio is 0.5-1 as determined by the HABA assay.
  • Form

    Lyophilised
  • Additional notes

    Biotinylation of this product is performed using Avitag™ technology. Briefly, the single lysine residue in the Avitag is enzymatically labeled with biotin.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon reconsitution add a carrier protein (0.1% BSA). Store at -20°C or -80°C. Avoid freeze / thaw cycle. Store In the Dark.

    pH: 7.40
    Constituents: PBS, 5% Trehalose

    0.22 µm filtered

  • Reconstitution
    It is recommended to reconstitute the lyophilized product in sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long-term storage.

General Info

  • Alternative names

    • 5T4
    • 5T4 oncofetal antigen
    • 5T4 oncofetal trophoblast glycoprotein
    • 5T4 oncotrophoblast glycoprotein
    • 5T4AG
    • AW495680
    • M6P1
    • TPBG
    • TPBG_HUMAN
    • Trophoblast glycoprotein
    see all
  • Tissue specificity

    Expressed by all types of trophoblasts as early as 9 weeks of development. Specific for trophoblastic cells except for amniotic epithelium. In adult tissues, the expression is limited to a few epithelial cell types but is found on a variety of carcinoma.
  • Sequence similarities

    Contains 6 LRR (leucine-rich) repeats.
    Contains 1 LRRCT domain.
    Contains 1 LRRNT domain.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • SDS-PAGE - Recombinant Human 5T4 protein (Tagged) (Biotin) (ab246200).

    The gel was stained overnight with Coomassie Blue.

    The protein migrates as 50-70 kDa under reducing conditions due to glycosylation.

References

ab246200 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab246200.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up