For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

  1. Link

    recombinant-human-67kda-laminin-receptor-protein-ab114294.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Cardiovascular Angiogenesis Adhesion / ECM Extracellular Matrix
Share by email

Recombinant Human 67kDa Laminin Receptor protein (ab114294)

  • Datasheet
Submit a review Q&A (1)

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

SDS-PAGE - Recombinant Human 67kDa Laminin Receptor protein (ab114294)

    Key features and details

    • Expression system: Wheat germ
    • Suitable for: WB, ELISA, SDS-PAGE

    Description

    • Product name

      Recombinant Human 67kDa Laminin Receptor protein
      See all 67kDa Laminin Receptor proteins and peptides
    • Expression system

      Wheat germ
    • Accession

      P08865
    • Protein length

      Full length protein
    • Animal free

      No
    • Nature

      Recombinant
      • Species

        Human
      • Sequence

        MSGALDVLQMKEEDVLKFLAAGTHLGGTNLDFQMEQYIYKRKSDGIYIIN LKRTWEKLLLAARAIVAIENPADVSVISSRNTGQRAVLKFAAATGATPIA GRFTPGTFTNQIQAAFREPRLLVVTDPRAGHQPLTEASYVNLPTIALCNT DSPLRYVDIAIPCNNKGAHSVGLMWWMLAREVLRMRGTISREHPWEVMPD LYFYRDPEEIEKEEQAAAEKAVTKEEFQGEWTAPAPEFTATQPEVADWSE GVQVPSVPIQQFPTEDWSAQPATEDWSAAPTAQATEWVGATTDWS
      • Predicted molecular weight

        59 kDa including tags
      • Amino acids

        1 to 295

    Associated products

    • Related Products

      • Anti-67kDa Laminin Receptor antibody (ab110499)
      • Anti-67kDa Laminin Receptor antibody (ab99484)

    Specifications

    Our Abpromise guarantee covers the use of ab114294 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    • Applications

      Western blot

      ELISA

      SDS-PAGE

    • Form

      Liquid
    • Concentration information loading...

    Preparation and Storage

    • Stability and Storage

      Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

      pH: 8.00
      Constituents: 0.3% Glutathione, 0.79% Tris HCl

    General Info

    • Alternative names

      • 34/67 kDa laminin receptor
      • 37 kDa laminin receptor precursor
      • 37/67 kDa laminin receptor
      • 37LRP
      • 40S ribosomal protein SA
      • 67 kDa laminin receptor
      • 67LR
      • Colon carcinoma laminin binding protein
      • Colon carcinoma laminin-binding protein
      • LAMBR
      • Laminin receptor 1
      • Laminin-binding protein precursor p40
      • LamR
      • LAMR 1
      • LAMR1
      • LBP
      • LBP/p40
      • LRP
      • LRP/LR
      • Multidrug resistance associated protein MGr1 Ag
      • Multidrug resistance associated protein MGr1Ag
      • Multidrug resistance-associated protein MGr1-Ag
      • NEM/1CHD4
      • p40
      • Ribosomal Protein SA
      • rpsA
      • RSSA_HUMAN
      • SA
      see all
    • Function

      Required for the assembly and/or stability of the 40S ribosomal subunit. Required for the processing of the 20S rRNA-precursor to mature 18S rRNA in a late step of the maturation of 40S ribosomal subunits. Also functions as a cell surface receptor for laminin. Plays a role in cell adhesion to the basement membrane and in the consequent activation of signaling transduction pathways. May play a role in cell fate determination and tissue morphogenesis. Acts as a PPP1R16B-dependent substrate of PPP1CA. Also acts as a receptor for several other ligands, including the pathogenic prion protein, viruses, and bacteria.
    • Sequence similarities

      Belongs to the ribosomal protein S2P family.
    • Post-translational
      modifications

      Acylated. Acylation may be a prerequisite for conversion of the monomeric 37 kDa laminin receptor precursor (37LRP) to the mature dimeric 67 kDa laminin receptor (67LR), and may provide a mechanism for membrane association.
      Cleaved by stromelysin-3 (ST3) at the cell surface. Cleavage by stromelysin-3 may be a mechanism to alter cell-extracellular matrix interactions.
    • Cellular localization

      Cell membrane. Cytoplasm. Nucleus. 67LR is found at the surface of the plasma membrane, with its C-terminal laminin-binding domain accessible to extracellular ligands. 37LRP is found at the cell surface, in the cytoplasm and in the nucleus (By similarity). Co-localizes with PPP1R16B in the cell membrane.
    • Target information above from: UniProt accession P08865 The UniProt Consortium
      The Universal Protein Resource (UniProt) in 2010
      Nucleic Acids Res. 38:D142-D148 (2010) .

      Information by UniProt

    Images

    • SDS-PAGE - Recombinant Human 67kDa Laminin Receptor protein (ab114294)
      SDS-PAGE - Recombinant Human 67kDa Laminin Receptor protein (ab114294)
      12.5% SDS-PAGE image showing ab114294 at approx 58.56kDa. Stained with Coomassie Blue.

    Protocols

    To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

    Click here to view the general protocols

    Datasheets and documents

    • Datasheet
  • References (0)

    Publishing research using ab114294? Please let us know so that we can cite the reference in this datasheet.

    ab114294 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    Question

    I would like to know if the 67kDa Laminin Receptor protein (ab114294) is active. I need to have the receptor conformation to bind a protein that the laminin receptor recognizes on the cell surface.

    Read More

    Abcam community

    Verified customer

    Asked on Jan 25 2013

    Answer

    Unfortunately, we haven’t tested if ab114294 is active nor the receptor conformation to bind a protein that the laminin receptor recognises on the cell surface.

    Read More

    Abcam Scientific Support

    Answered on Jan 25 2013

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2021 Abcam plc. All rights reserved.