Recombinant Human 67kDa Laminin Receptor protein (ab114294)
Key features and details
- Expression system: Wheat germ
- Suitable for: WB, ELISA, SDS-PAGE
Description
-
Product name
Recombinant Human 67kDa Laminin Receptor protein
See all 67kDa Laminin Receptor proteins and peptides -
Expression system
Wheat germ -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
MSGALDVLQMKEEDVLKFLAAGTHLGGTNLDFQMEQYIYKRKSDGIYIIN LKRTWEKLLLAARAIVAIENPADVSVISSRNTGQRAVLKFAAATGATPIA GRFTPGTFTNQIQAAFREPRLLVVTDPRAGHQPLTEASYVNLPTIALCNT DSPLRYVDIAIPCNNKGAHSVGLMWWMLAREVLRMRGTISREHPWEVMPD LYFYRDPEEIEKEEQAAAEKAVTKEEFQGEWTAPAPEFTATQPEVADWSE GVQVPSVPIQQFPTEDWSAQPATEDWSAAPTAQATEWVGATTDWS -
Predicted molecular weight
59 kDa including tags -
Amino acids
1 to 295
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab114294 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Western blot
ELISA
SDS-PAGE
-
Form
Liquid -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.
pH: 8.00
Constituents: 0.3% Glutathione, 0.79% Tris HCl
General Info
-
Alternative names
- 34/67 kDa laminin receptor
- 37 kDa laminin receptor precursor
- 37/67 kDa laminin receptor
see all -
Function
Required for the assembly and/or stability of the 40S ribosomal subunit. Required for the processing of the 20S rRNA-precursor to mature 18S rRNA in a late step of the maturation of 40S ribosomal subunits. Also functions as a cell surface receptor for laminin. Plays a role in cell adhesion to the basement membrane and in the consequent activation of signaling transduction pathways. May play a role in cell fate determination and tissue morphogenesis. Acts as a PPP1R16B-dependent substrate of PPP1CA. Also acts as a receptor for several other ligands, including the pathogenic prion protein, viruses, and bacteria. -
Sequence similarities
Belongs to the ribosomal protein S2P family. -
Post-translational
modificationsAcylated. Acylation may be a prerequisite for conversion of the monomeric 37 kDa laminin receptor precursor (37LRP) to the mature dimeric 67 kDa laminin receptor (67LR), and may provide a mechanism for membrane association.
Cleaved by stromelysin-3 (ST3) at the cell surface. Cleavage by stromelysin-3 may be a mechanism to alter cell-extracellular matrix interactions. -
Cellular localization
Cell membrane. Cytoplasm. Nucleus. 67LR is found at the surface of the plasma membrane, with its C-terminal laminin-binding domain accessible to extracellular ligands. 37LRP is found at the cell surface, in the cytoplasm and in the nucleus (By similarity). Co-localizes with PPP1R16B in the cell membrane. - Information by UniProt
Images
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab114294 has not yet been referenced specifically in any publications.